Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007175 [exp] 207 / 6e-68 AT5G27260 67 / 2e-12 unknown protein Lus10022379 [exp] 90 / 1e-22 AT5G27260 74 / 1e-14 unknown protein Lus10006034 [exp] 89 / 2e-22 AT5G27260 42 / 2e-04 unknown protein Lus10018174 [exp] 89 / 2e-22 AT5G41980 68 / 1e-12 unknown protein Lus10004397 [exp] 89 / 2e-22 AT5G27260 77 / 6e-16 unknown protein Lus10034368 [exp] 88 / 3e-22 AT5G38900 147 / 2e-43 Thioredoxin superfamily protein (.1) Lus10010798 [exp] 89 / 7e-22 AT5G27260 61 / 5e-10 unknown protein Lus10032348 [exp] 86 / 8e-21 AT5G27260 52 / 2e-07 unknown protein Lus10037335 [exp] 86 / 8e-21 AT5G27260 69 / 7e-13 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G215600 [exp] 42 / 2e-05 AT4G02550 77 / 7e-16 unknown protein Potri.011G163248 [exp] 42 / 2e-05 AT4G02550 93 / 4e-22 unknown protein Potri.006G191850 [exp] 41 / 2e-05 AT4G02550 71 / 2e-15 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004902 pacid=23177755 polypeptide=Lus10004902 locus=Lus10004902.g ID=Lus10004902.BGIv1.0 annot-version=v1.0 ATGGCTCCTAGAAAGGACAAAGAAGATATCGACATGGAATATTTCGCATGGAATAGCACACTTGAAAACTCTTTGATTGAATGTATGGGGGAGTTGGTTG CTAAAAACCATATTGAGAATGGTGTTTTTAAGGGAGGGGCGTACAAGGAGTTGGAGAAAATGATGGAGTCGAAGGTCCTTGGCAGTGGGATTATGGCTTA TCCACATATCAAATCAAGGTTGAAGATATTAAAAACTAAACATCAAGCTTACCAGCTACGCAGAGGTCAAAGTGGATGGGGCTGGGATGATGCGGCGAAG TGTCTAGTCGTGGACAATGATATTTTCAACAACTTTGTGATGGTATGA
AA sequence Show only first row Show all	>Lus10004902 pacid=23177755 polypeptide=Lus10004902 locus=Lus10004902.g ID=Lus10004902.BGIv1.0 annot-version=v1.0 MAPRKDKEDIDMEYFAWNSTLENSLIECMGELVAKNHIENGVFKGGAYKELEKMMESKVLGSGIMAYPHIKSRLKILKTKHQAYQLRRGQSGWGWDDAAK CLVVDNDIFNNFVMV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10004902 [exp]	0	1
AT2G41660		MIZ1	mizu-kussei 1, Protein of unkn...		Lus10035443 [exp]	3.0	0.7494
AT2G29040			Exostosin family protein (.1)		Lus10001578 [exp]	9.8	0.7467
					Lus10029261 [exp]	15.2	0.7169
AT5G56990			unknown protein		Lus10029528 [exp]	17.5	0.7169
AT4G27420		ABCG9	ATP-binding cassette G9, ABC-2...		Lus10029635 [exp]	19.6	0.7169
					Lus10038051 [exp]	21.5	0.7169
AT1G16930			F-box/RNI-like/FBD-like domain...		Lus10023036 [exp]	21.8	0.6851
AT1G06340			Plant Tudor-like protein (.1)		Lus10039027 [exp]	22.2	0.6851
AT5G36220		CYP91A1, CYP81D...	CYTOCHROME P450 91A1, cytochro...		Lus10018718 [exp]	22.6	0.6851
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Lus10026169 [exp]	23.1	0.6851

Compare expression of checked genes

Lus10004902 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.