Plant FIBer expression Database

Lus10004910 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G43150 43 / 6e-07 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010543
[exp]
121 / 6e-38 AT5G43150 45 / 1e-07 unknown protein
Lus10015934
[exp]
60 / 3e-12 AT2G27410 48 / 3e-06 Domain of unknown function (DUF313) (.1)
Lus10041628
[exp]
39 / 2e-05 AT5G43150 52 / 3e-10 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G088200
[exp]
95 / 9e-28 AT5G43150 40 / 8e-06 unknown protein
Potri.008G152200
[exp]
96 / 2e-27 AT5G43150 41 / 9e-06 unknown protein
Potri.013G037800
[exp]
87 / 2e-24 AT5G43150 39 / 2e-05 unknown protein
Potri.005G211000
[exp]
84 / 3e-23 ND /
Potri.003G187500
[exp]
43 / 6e-07 AT5G43150 51 / 8e-10 unknown protein
Potri.001G037400
[exp]
40 / 6e-06 AT5G43150 56 / 1e-11 unknown protein
Potri.002G119700
[exp]
37 / 0.0002 AT5G43150 58 / 1e-12 unknown protein
PFAM info
Representative CDS sequence
>Lus10004910 pacid=23177742 polypeptide=Lus10004910 locus=Lus10004910.g ID=Lus10004910.BGIv1.0 annot-version=v1.0
ATGGGGTGGCTTCAATCCCTCTTCTCCCCATTGAAGAAGCTCTGGTTCCGCCTCCACACCACCACTCCTAACAAGAGAGGTAGAGGGATATACATTCTAT
ACGAGGATGTGAAGTCATGTCCATACGAAGATGTTCATGTTCTGTGGTCTATACTGGTAGAGTCTCATGATTCCCCTTCTTCCCCTAACCTGCTACAGCT
GCAGCAGCAGCCGCCGAAAGAATGA
AA sequence
>Lus10004910 pacid=23177742 polypeptide=Lus10004910 locus=Lus10004910.g ID=Lus10004910.BGIv1.0 annot-version=v1.0
MGWLQSLFSPLKKLWFRLHTTTPNKRGRGIYILYEDVKSCPYEDVHVLWSILVESHDSPSSPNLLQLQQQPPKE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G43150 unknown protein Lus10004910
[exp]
0 1
AT5G43150 unknown protein Lus10010543
[exp]
1.0 0.9741
AT1G27200 Domain of unknown function (DU... Lus10030815
[exp]
2.0 0.9243
AT1G15380 GLYI4 glyoxylase I 4, Lactoylglutath... Lus10014269
[exp]
2.6 0.8913
AT4G33040 Thioredoxin superfamily protei... Lus10013519
[exp]
3.5 0.9109
AT5G55490 GEX1, ATGEX1 gamete expressed protein 1 (.1... Lus10039900
[exp]
3.9 0.8596
AT5G65380 MATE efflux family protein (.1... Lus10015903
[exp]
4.0 0.8594
AT1G08500 AtENODL18 early nodulin-like protein 18 ... Lus10036067
[exp]
4.5 0.8961
AT1G27200 Domain of unknown function (DU... Lus10013291
[exp]
6.6 0.9017
AT2G30860 GLUTTR, ATGSTF7... glutathione S-transferase PHI ... Lus10001419
[exp]
7.3 0.8920
AT3G10680 HSP20-like chaperones superfam... Lus10034875
[exp]
10.6 0.8347

Lus10004910 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.