Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07720 100 / 5e-26 KCS3 3-ketoacyl-CoA synthase 3 (.1) AT2G28630 97 / 3e-25 KCS12 3-ketoacyl-CoA synthase 12 (.1) AT5G04530 61 / 4e-12 KCS19 3-ketoacyl-CoA synthase 19 (.1) AT1G19440 44 / 3e-06 KCS4 3-ketoacyl-CoA synthase 4 (.1) AT2G15090 40 / 4e-05 KCS8 3-ketoacyl-CoA synthase 8 (.1) AT2G26250 39 / 0.0001 KCS10, FDH FIDDLEHEAD, 3-ketoacyl-CoA synthase 10 (.1) AT1G68530 39 / 0.0001 KCS6, CER6, POP1, G2, CUT1 POLLEN-PISTIL INCOMPATIBILITY 1, CUTICULAR 1, ECERIFERUM 6, 3-ketoacyl-CoA synthase 6 (.1.2) AT1G25450 39 / 0.0002 KCS5, CER60 ECERIFERUM 60, 3-ketoacyl-CoA synthase 5 (.1) AT4G34520 38 / 0.0004 KCS18, FAE1 FATTY ACID ELONGATION1, 3-ketoacyl-CoA synthase 18 (.1) AT5G49070 38 / 0.0004 KCS21 3-ketoacyl-CoA synthase 21 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040873 [exp] 137 / 1e-40 AT2G28630 546 / 0.0 3-ketoacyl-CoA synthase 12 (.1) Lus10005434 [exp] 117 / 2e-32 AT2G28630 664 / 0.0 3-ketoacyl-CoA synthase 12 (.1) Lus10015222 [exp] 116 / 4e-32 AT2G28630 654 / 0.0 3-ketoacyl-CoA synthase 12 (.1) Lus10023458 [exp] 72 / 4e-16 AT5G04530 605 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Lus10040333 [exp] 71 / 6e-16 AT5G04530 611 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Lus10039906 [exp] 66 / 3e-14 AT5G04530 497 / 1e-172 3-ketoacyl-CoA synthase 19 (.1) Lus10002191 [exp] 64 / 2e-13 AT5G04530 495 / 1e-173 3-ketoacyl-CoA synthase 19 (.1) Lus10002190 [exp] 52 / 1e-09 AT2G28630 171 / 3e-52 3-ketoacyl-CoA synthase 12 (.1) Lus10033627 [exp] 49 / 5e-08 AT5G04530 376 / 2e-128 3-ketoacyl-CoA synthase 19 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G026800 [exp] 104 / 7e-28 AT2G28630 660 / 0.0 3-ketoacyl-CoA synthase 12 (.1) Potri.001G234500 [exp] 97 / 2e-25 AT2G28630 647 / 0.0 3-ketoacyl-CoA synthase 12 (.1) Potri.013G119600 [exp] 81 / 2e-19 AT5G04530 561 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Potri.010G212600 [exp] 78 / 2e-18 AT5G04530 576 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Potri.019G091600 [exp] 75 / 3e-17 AT5G04530 520 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Potri.013G119800 [exp] 64 / 1e-13 AT5G04530 558 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Potri.013G120100 [exp] 53 / 1e-09 AT5G04530 543 / 0.0 3-ketoacyl-CoA synthase 19 (.1) Potri.014G196200 [exp] 45 / 9e-07 AT1G19440 854 / 0.0 3-ketoacyl-CoA synthase 4 (.1) Potri.009G116700 [exp] 44 / 2e-06 AT1G19440 899 / 0.0 3-ketoacyl-CoA synthase 4 (.1) Potri.004G155600 [exp] 43 / 5e-06 AT1G19440 899 / 0.0 3-ketoacyl-CoA synthase 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004919 pacid=23177757 polypeptide=Lus10004919 locus=Lus10004919.g ID=Lus10004919.BGIv1.0 annot-version=v1.0 ATGATAAGTTTCGGGGCGGGGTTCAAGTGTAACAGCTGTCTGTGGGAGGTGGTGAGGGATCTGGGCGGTGGGTCGGGATCCGGGTCGGGTTGTGGGGCGA CGGTGTGGAATGACTGCATTGACAGCTATCCACCGGAGTCGTTGGCCAACCCATTCATGACAAAGTACGGGTGGATTAACGACGAGGATCCCGCCACTTT TGTGCTTCCTGAGGAAAATCCAGTCAGGACGGTGAACGGAATAGATTCACAGTCGCTTGTGATTGGCTGA
AA sequence Show only first row Show all	>Lus10004919 pacid=23177757 polypeptide=Lus10004919 locus=Lus10004919.g ID=Lus10004919.BGIv1.0 annot-version=v1.0 MISFGAGFKCNSCLWEVVRDLGGGSGSGSGCGATVWNDCIDSYPPESLANPFMTKYGWINDEDPATFVLPEENPVRTVNGIDSQSLVIG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G28630		KCS12	3-ketoacyl-CoA synthase 12 (.1...		Lus10004919 [exp]	0	1
AT2G17650			AMP-dependent synthetase and l...		Lus10041825 [exp]	1.4	0.9794
AT2G17650			AMP-dependent synthetase and l...		Lus10041826 [exp]	2.0	0.9741
AT1G60010			unknown protein		Lus10010708 [exp]	3.0	0.9488
AT5G07980			dentin sialophosphoprotein-rel...		Lus10034692 [exp]	6.5	0.8922
AT2G16850		PIP3B, PIP2;8	PLASMA MEMBRANE INTRINSIC PROT...		Lus10027467 [exp]	10.6	0.8890
AT4G00620		EMB3127	EMBRYO DEFECTIVE 3127, Amino a...		Lus10012502 [exp]	11.0	0.7755
AT2G02950		PKS1	phytochrome kinase substrate 1...		Lus10024228 [exp]	12.0	0.8881
AT1G27950		LTPG1	glycosylphosphatidylinositol-a...		Lus10006413 [exp]	13.6	0.9005
AT5G13460		IQD11	IQ-domain 11 (.1)		Lus10039573 [exp]	14.5	0.8740
AT5G19790	AP2_ERF	RAP2.11	related to AP2 11 (.1)		Lus10013614 [exp]	16.7	0.8854

Compare expression of checked genes

Lus10004919 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.