Lus10004923 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014359 38 / 0.0008 AT3G18990 79 / 1e-16 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G191500 39 / 0.0004 AT3G18990 189 / 5e-57 REDUCED VERNALIZATION RESPONSE 1, REPRODUCTIVE MERISTEM 39, AP2/B3-like transcriptional factor family protein (.1)
PFAM info
Representative CDS sequence
>Lus10004923 pacid=23177772 polypeptide=Lus10004923 locus=Lus10004923.g ID=Lus10004923.BGIv1.0 annot-version=v1.0
ATGAAGAAACTAACTCTCTGTTGGTCTCACAGCATGTGGAGATCGGGTTTTCGGAGAAGTACATCAAGGAGCTTCGTGGAGAAGCTGTGTTCGAGCTTGC
GGAGACGGGAAGAACTTGGACTGTTGGGTACGATTCCTACCTTTGCTAGGGATGCCAATCTGAAAGCTGGGGATATCTGTGCTTTCGAGCTTATGGAACT
CGATCCGCTTCAACTCAAAGTGACCATCTTGCCCCCCCGGAGCCCAAACGCACCTGTCACGGGTCATCTCGCAGGGTTTTCGAGAAAGGAGAGAGTTCAA
GGAGAAACATGTAGGCCTGGTTCGACAAAGAAGCAGCTAAGGTGGCTTAACGTAGGCTTTTCGGATTAG
AA sequence
>Lus10004923 pacid=23177772 polypeptide=Lus10004923 locus=Lus10004923.g ID=Lus10004923.BGIv1.0 annot-version=v1.0
MKKLTLCWSHSMWRSGFRRSTSRSFVEKLCSSLRRREELGLLGTIPTFARDANLKAGDICAFELMELDPLQLKVTILPPRSPNAPVTGHLAGFSRKERVQ
GETCRPGSTKKQLRWLNVGFSD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10004923 0 1
AT5G63135 unknown protein Lus10019491 1.7 0.8543
AT5G41610 ATCHX18 cation/H+ exchanger 18, ARABID... Lus10028748 8.7 0.8631
AT3G54750 unknown protein Lus10012287 15.6 0.8615
AT2G18360 alpha/beta-Hydrolases superfam... Lus10028302 22.6 0.7666
AT3G27330 zinc finger (C3HC4-type RING f... Lus10014874 22.8 0.7653
Lus10006316 25.5 0.8374
AT4G18040 LSP1, CUM1, AT.... eukaryotic translation Initiat... Lus10002785 28.0 0.7827
AT3G48710 DEK domain-containing chromati... Lus10025759 28.5 0.8356
AT1G72610 ATGER1, GLP1 A. THALIANA GERMIN-LIKE PROTEI... Lus10037666 37.7 0.8381
AT4G11410 NAD(P)-binding Rossmann-fold s... Lus10024646 38.5 0.7774

Lus10004923 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.