Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06475 47 / 7e-08 unknown protein AT5G46295 43 / 1e-06 unknown protein AT5G49525 36 / 0.0006 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025392 [exp] 95 / 2e-26 AT1G06475 59 / 1e-12 unknown protein Lus10015269 [exp] 94 / 5e-26 AT1G06475 59 / 1e-12 unknown protein Lus10020752 [exp] 41 / 3e-05 AT1G06475 51 / 2e-09 unknown protein Lus10011181 [exp] 38 / 0.0001 AT5G49525 50 / 5e-10 unknown protein Lus10007328 [exp] 39 / 0.0002 AT1G06475 51 / 3e-09 unknown protein Lus10015445 [exp] 37 / 0.0004 ND 49 / 2e-09
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G131200 [exp] 78 / 4e-20 AT5G46295 / unknown protein Potri.011G079900 [exp] 74 / 2e-18 AT5G46295 57 / 3e-12 unknown protein Potri.005G203800 [exp] 54 / 5e-11 AT1G06475 64 / 5e-15 unknown protein Potri.002G058400 [exp] 50 / 3e-09 AT1G06475 64 / 5e-15 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004931 pacid=23177744 polypeptide=Lus10004931 locus=Lus10004931.g ID=Lus10004931.BGIv1.0 annot-version=v1.0 ATGAGGAACCACCGCGAAGACGAAGAAGCCGAAGCAATTAGATGCGCCGGCGAAGGCATATCCGCCGCCGAATCCATTATCCCTAGCCTATTCGTCTCTG GCGGCGGCGGAAAGATTAGGAAGAAGAGAACAGGATTGTGGCTATTCATCAGGAAGCTGAAATTCAACAAGGAATCGCTCAGGTGGAGGTGGAAGTTCTT GTCGTCGGCTTTCAAGCGGAAGCGAATCAAGCTCGTCGACGACGCACTCTTCAAGATCGCCTCTGTTCTCGAGGCGATCGTTCTTGTCGCCACCGTTTCT TTCTTCTACCTCTGCTGCGGCTGTAACTTCTGA
AA sequence Show only first row Show all	>Lus10004931 pacid=23177744 polypeptide=Lus10004931 locus=Lus10004931.g ID=Lus10004931.BGIv1.0 annot-version=v1.0 MRNHREDEEAEAIRCAGEGISAAESIIPSLFVSGGGGKIRKKRTGLWLFIRKLKFNKESLRWRWKFLSSAFKRKRIKLVDDALFKIASVLEAIVLVATVS FFYLCCGCNF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G06475			unknown protein		Lus10004931 [exp]	0	1
AT4G39830			Cupredoxin superfamily protein...		Lus10016808 [exp]	2.2	0.9567
AT5G36970		NHL25	NDR1/HIN1-like 25 (.1)		Lus10020783 [exp]	8.8	0.9636
AT1G72310		ATL3	RING/U-box superfamily protein...		Lus10019686 [exp]	12.0	0.9450
AT2G35980		NHL10, YLS9, AT...	YELLOW-LEAF-SPECIFIC GENE 9, A...		Lus10021288 [exp]	12.4	0.9628
AT5G01180		ATPTR5	ARABIDOPSIS THALIANA PEPTIDE T...		Lus10040698 [exp]	13.4	0.9529
					Lus10027915 [exp]	15.6	0.9481
AT2G21620		RD2	Adenine nucleotide alpha hydro...		Lus10042317 [exp]	15.7	0.9342
					Lus10031841 [exp]	17.3	0.9560
AT2G42010		PLDBETA1	phospholipase D beta 1 (.1)		Lus10014146 [exp]	18.2	0.9607
AT1G17860			Kunitz family trypsin and prot...		Lus10011090 [exp]	19.2	0.9460

Compare expression of checked genes

Lus10004931 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.