Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59613 97 / 8e-29 unknown protein AT3G46430 97 / 8e-29 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005449 [exp] 115 / 2e-36 AT3G46430 96 / 9e-29 unknown protein Lus10005899 [exp] 115 / 7e-36 AT5G59613 96 / 7e-28 unknown protein Lus10040848 [exp] 114 / 9e-36 AT5G59613 96 / 2e-28 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G053000 [exp] 100 / 4e-30 AT5G59613 92 / 5e-27 unknown protein Potri.010G207600 [exp] 99 / 9e-30 AT5G59613 92 / 4e-27 unknown protein Potri.010G183951 [exp] 37 / 6e-05 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10004950 pacid=23174821 polypeptide=Lus10004950 locus=Lus10004950.g ID=Lus10004950.BGIv1.0 annot-version=v1.0 ATGAGGAGGTTGTTCGATCCGTGGCCAGTTTTCTTCAAGCGGGAATGGAATAGGAACTGGCCTTTCCTGGTCGGTTTCGCCGTCACCGGCACCATCATCA CCAAGATGTCCCTCGGTCTCACTGAGGAGGATGCTAAGAACTCCAAGTTCGTTCAGAGGCACAAGTAG
AA sequence Show only first row Show all	>Lus10004950 pacid=23174821 polypeptide=Lus10004950 locus=Lus10004950.g ID=Lus10004950.BGIv1.0 annot-version=v1.0 MRRLFDPWPVFFKREWNRNWPFLVGFAVTGTIITKMSLGLTEEDAKNSKFVQRHK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G46430			unknown protein		Lus10004950 [exp]	0	1
AT5G55940		EMB2731	embryo defective 2731, Unchara...		Lus10043155 [exp]	10.5	0.7914
AT2G46330		ATAGP16, AGP16	arabinogalactan protein 16 (.1...		Lus10000542 [exp]	22.8	0.8205
AT4G18100			Ribosomal protein L32e (.1)		Lus10007541 [exp]	25.1	0.7827
AT5G40080			Mitochondrial ribosomal protei...		Lus10011032 [exp]	28.5	0.8069
AT5G19580			glyoxal oxidase-related protei...		Lus10011109 [exp]	31.3	0.7860
AT5G18790			Ribosomal protein L33 family p...		Lus10012786 [exp]	37.8	0.7982
AT2G30620			winged-helix DNA-binding trans...		Lus10022001 [exp]	39.8	0.7814
AT5G20850		ATRAD51	RAS associated with diabetes p...		Lus10027654 [exp]	44.1	0.8018
AT5G49665			Zinc finger (C3HC4-type RING f...		Lus10042930 [exp]	45.2	0.7864
AT2G47640			Small nuclear ribonucleoprotei...		Lus10030367 [exp]	46.1	0.7822

Compare expression of checked genes

Lus10004950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.