Plant FIBer expression Database

Lus10004952 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G46450 46 / 1e-07 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005452
[exp]
101 / 5e-27 AT3G46450 417 / 2e-142 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein (.1.2)
Lus10040845
[exp]
61 / 1e-12 AT3G46450 453 / 3e-156 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G028700
[exp]
59 / 5e-12 AT3G46450 472 / 4e-164 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein (.1.2)
Potri.001G237400
[exp]
52 / 1e-09 AT3G46450 446 / 7e-154 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10004952 pacid=23174816 polypeptide=Lus10004952 locus=Lus10004952.g ID=Lus10004952.BGIv1.0 annot-version=v1.0
ATGGACAAGAGGGAGCATCGCGGGTACATTGGTGACCGTGATGATGATCGGACCTTGTTGCTTATGGATACGGAGGTCGATAGTTCTGCGAACGCTGAGT
GGGACCGCTTGCTGAAGACGGCGGTAATCGGCATTCTCATGTCGTGGATTTTTGTGGCCTTGGTTGTTGGATTCTACGATCCTGAAACTCGTCCCTTTTA
G
AA sequence
>Lus10004952 pacid=23174816 polypeptide=Lus10004952 locus=Lus10004952.g ID=Lus10004952.BGIv1.0 annot-version=v1.0
MDKREHRGYIGDRDDDRTLLLMDTEVDSSANAEWDRLLKTAVIGILMSWIFVALVVGFYDPETRPF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G46450 SEC14 cytosolic factor family ... Lus10004952
[exp]
0 1
AT3G62820 Plant invertase/pectin methyle... Lus10007873
[exp]
2.2 0.8202
AT2G46240 ATBAG6, BAG6 ARABIDOPSIS THALIANA BCL-2-ASS... Lus10010133
[exp]
8.6 0.8412
AT3G06170 Serinc-domain containing serin... Lus10004430
[exp]
9.9 0.8125
AT2G32120 HSP70T-2 heat-shock protein 70T-2 (.1.2... Lus10041207
[exp]
12.0 0.8394
AT4G29120 6-phosphogluconate dehydrogena... Lus10034975
[exp]
13.0 0.8126
AT2G20560 DNAJ heat shock family protein... Lus10017687
[exp]
13.1 0.8225
AT5G03340 ATPase, AAA-type, CDC48 protei... Lus10023018
[exp]
14.5 0.8031
AT3G23920 BAM1, BMY7, TR-... BETA-AMYLASE 7, beta-amylase 1... Lus10004396
[exp]
15.5 0.8011
AT3G24500 MBF1C, ATMBF1C multiprotein bridging factor 1... Lus10034592
[exp]
18.8 0.8340
AT3G57340 Heat shock protein DnaJ, N-ter... Lus10030079
[exp]
21.0 0.8059

Lus10004952 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.