Lus10004960 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10004960 pacid=23174824 polypeptide=Lus10004960 locus=Lus10004960.g ID=Lus10004960.BGIv1.0 annot-version=v1.0
ATGGATAATCACAAAGCTAAAAGGAAAAATTATTCCTTCTTTCCTTCGGGAAAACATTATTTCCCCTCTGCCGAAGTCAAAGTTCTGCGCTTGTTCTCCG
CATTTCGCCGACCAACCTGTCGCCCGGAGTATCGCAGAAATCTAGTTTCCGGCCAGTCTTCTTCCATCTTTATCAACCGAAGATCAAGCCTTTCTGCATC
GTCCCCTCAACATCACCGGCTGCTATCCGAACTGCCTTGCAACCCACAGCTGAAAGGAAAACACGAATCGGATTCACGTTACCGATTTGAAGCGGATCCT
CCTGGTTCCAGAACTCTACATCTTCTGATCCCTCCATCAATCTCTGCTGGTAACTTGGCAAATGCAGTGTTAGTTCATGCACCTTATGCTAGTCTAGAGA
ATCCTTATGAGTTTACAAGTCTGGAGTTTAGCTCGCTAGGCTGTAGAGCAGAAAATGTGGAAGTTCATGTATGA
AA sequence
>Lus10004960 pacid=23174824 polypeptide=Lus10004960 locus=Lus10004960.g ID=Lus10004960.BGIv1.0 annot-version=v1.0
MDNHKAKRKNYSFFPSGKHYFPSAEVKVLRLFSAFRRPTCRPEYRRNLVSGQSSSIFINRRSSLSASSPQHHRLLSELPCNPQLKGKHESDSRYRFEADP
PGSRTLHLLIPPSISAGNLANAVLVHAPYASLENPYEFTSLEFSSLGCRAENVEVHV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10004960 0 1
AT5G09630 LisH/CRA/RING-U-box domains-co... Lus10007106 2.8 0.8498
AT1G09850 XBCP3 xylem bark cysteine peptidase ... Lus10006130 3.7 0.8528
AT2G29950 ELF4-L1 ELF4-like 1 (.1) Lus10018237 4.5 0.8149
AT3G48410 alpha/beta-Hydrolases superfam... Lus10034135 5.1 0.8048
AT2G28910 CXIP4 CAX interacting protein 4 (.1) Lus10005458 9.3 0.8482
AT4G12240 C2H2ZnF zinc finger (C2H2 type) family... Lus10032208 20.5 0.7190
AT2G28910 CXIP4 CAX interacting protein 4 (.1) Lus10004961 20.7 0.8124
AT3G01130 unknown protein Lus10042059 23.2 0.8349
AT2G16940 Splicing factor, CC1-like (.1.... Lus10034466 26.7 0.8428
AT2G39840 TOPP4 type one serine/threonine prot... Lus10042559 30.5 0.8446

Lus10004960 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.