Lus10004986 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59180 324 / 3e-115 NRPB7 DNA-directed RNA polymerase II (.1)
AT4G14660 74 / 1e-16 NRPE7 RNA polymerase Rpb7-like, N-terminal domain (.1)
AT3G22900 70 / 4e-15 NRPD7 RNA polymerase Rpb7-like, N-terminal domain (.1)
AT1G06790 49 / 2e-07 RNA polymerase Rpb7 N-terminal domain-containing protein (.1.2)
AT4G14520 48 / 4e-07 DNA-directed RNA polymerase II-related (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001559 349 / 4e-125 AT5G59180 331 / 5e-118 DNA-directed RNA polymerase II (.1)
Lus10023619 71 / 2e-15 AT4G14660 266 / 2e-92 RNA polymerase Rpb7-like, N-terminal domain (.1)
Lus10023620 69 / 1e-14 AT4G14660 205 / 3e-68 RNA polymerase Rpb7-like, N-terminal domain (.1)
Lus10024250 68 / 2e-14 AT4G14660 263 / 5e-91 RNA polymerase Rpb7-like, N-terminal domain (.1)
Lus10035380 50 / 7e-08 AT1G06790 235 / 3e-79 RNA polymerase Rpb7 N-terminal domain-containing protein (.1.2)
Lus10024251 40 / 8e-05 AT4G14660 117 / 1e-34 RNA polymerase Rpb7-like, N-terminal domain (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G377200 333 / 8e-119 AT5G59180 340 / 1e-121 DNA-directed RNA polymerase II (.1)
Potri.008G161700 77 / 6e-18 AT4G14660 293 / 5e-103 RNA polymerase Rpb7-like, N-terminal domain (.1)
Potri.010G077300 76 / 1e-17 AT4G14660 261 / 3e-90 RNA polymerase Rpb7-like, N-terminal domain (.1)
Potri.010G077200 68 / 3e-14 AT4G14660 171 / 1e-54 RNA polymerase Rpb7-like, N-terminal domain (.1)
Potri.002G044500 41 / 0.0001 AT1G06790 228 / 1e-76 RNA polymerase Rpb7 N-terminal domain-containing protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0319 SHS2 PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
CL0021 OB PF00575 S1 S1 RNA binding domain
Representative CDS sequence
>Lus10004986 pacid=23174817 polypeptide=Lus10004986 locus=Lus10004986.g ID=Lus10004986.BGIv1.0 annot-version=v1.0
ATGTTCTTCCACATTGTTCTTGAGCGGAACATGCAGCTGCACCCTCGCTATTTCGGTCGCAACCTTCGCGATAACCTCGTCTCCAAGCTCATGAAAGACG
TCGAGGGAACTTGCGGGGGGGAGGATGGGTTTGTGGTAGCCATAACTGGTATAGAAAGCGTTGGGAAAGGGTTGATCAGAGATGGCACAGGTTTCGTGAC
GTTTCCAGTGAAGTACCAGTGCGTTGTGTTCAGACCATTCAAAGGTGAAGTCCTGGAAGCTGTTGTGACCCTGGTAAACAAGATGGGATTTTTCGCAGAA
GCTGGTCCGGTGCAGATTTTCGTGTCGAACCATTTGATACCAGATGACATGGAGTTTCAAAATGGAGATATGCCGAACTATACGACTTTAGATGGATCGG
TTAAGATCCAGAAGGATAGTGAAGTGCGTCTGAAGTTAATTGGAACCCGTGTCGATGCAACAGAAATCTTCTGCATCGGGACGATAAAGGACGACTTCTT
GGGTGTGATCAATGATCCTACTACTACATAA
AA sequence
>Lus10004986 pacid=23174817 polypeptide=Lus10004986 locus=Lus10004986.g ID=Lus10004986.BGIv1.0 annot-version=v1.0
MFFHIVLERNMQLHPRYFGRNLRDNLVSKLMKDVEGTCGGEDGFVVAITGIESVGKGLIRDGTGFVTFPVKYQCVVFRPFKGEVLEAVVTLVNKMGFFAE
AGPVQIFVSNHLIPDDMEFQNGDMPNYTTLDGSVKIQKDSEVRLKLIGTRVDATEIFCIGTIKDDFLGVINDPTTT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G59180 NRPB7 DNA-directed RNA polymerase II... Lus10004986 0 1
AT3G18760 Translation elongation factor... Lus10006729 6.9 0.8275
AT2G34970 Trimeric LpxA-like enzyme (.1) Lus10033841 23.2 0.8079
AT5G50810 TIM8 translocase inner membrane sub... Lus10022450 23.7 0.8084
AT5G02610 Ribosomal L29 family protein ... Lus10024437 27.5 0.7946
AT2G46090 Diacylglycerol kinase family p... Lus10007917 28.1 0.7526
AT4G18100 Ribosomal protein L32e (.1) Lus10007541 28.6 0.7776
AT3G49100 Signal recognition particle, S... Lus10018775 30.9 0.8054
AT5G18790 Ribosomal protein L33 family p... Lus10012786 33.4 0.8041
AT1G19100 Histidine kinase-, DNA gyrase ... Lus10001240 34.6 0.7589
AT2G33370 Ribosomal protein L14p/L23e fa... Lus10023730 38.9 0.8042

Lus10004986 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.