Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G73820 119 / 1e-35 Ssu72-like family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024545 [exp] 144 / 1e-45 AT1G73820 314 / 6e-111 Ssu72-like family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G036600 [exp] 119 / 2e-35 AT1G73820 340 / 4e-121 Ssu72-like family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0031 [flax] [poplar] Phosphatase PF04722 [flax] [poplar] Ssu72 Ssu72-like protein
Representative CDS sequence Show only first row Show all	>Lus10005003 pacid=23182073 polypeptide=Lus10005003 locus=Lus10005003.g ID=Lus10005003.BGIv1.0 annot-version=v1.0 ATGGAATCCCACGCACTGCTCAAGCGTCATGGCTTCGACGTCTCTTCCTATGGAACCGGTTCTCAGGTCAAGCTCCCTGGACCTTCCATTCGAGAGCCCA ATGTGTACGACTTCGGTACCCCTTACAAGCACATGTTCGAAGAACTCAGACATCTCCGTAACAGAGATCATGTTCGTCTGAAGACCGTTTTAGTGATCAA CCTTGAAGTGAAAGACAACCATGAGGACGCGTCTATGGGGGCTAGACTCGCATTAGACCTTTGCCAAGTGTAA
AA sequence Show only first row Show all	>Lus10005003 pacid=23182073 polypeptide=Lus10005003 locus=Lus10005003.g ID=Lus10005003.BGIv1.0 annot-version=v1.0 MESHALLKRHGFDVSSYGTGSQVKLPGPSIREPNVYDFGTPYKHMFEELRHLRNRDHVRLKTVLVINLEVKDNHEDASMGARLALDLCQV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G73820			Ssu72-like family protein (.1)		Lus10005003 [exp]	0	1
AT4G05020		NDB2	NAD(P)H dehydrogenase B2 (.1),...		Lus10006737 [exp]	117.5	0.7431
AT1G16750			Protein of unknown function, D...		Lus10039917 [exp]	140.7	0.7372
AT3G52160		KCS15	3-ketoacyl-CoA synthase 15 (.1...		Lus10000219 [exp]	198.6	0.7314
AT2G44890		CYP704A1	"cytochrome P450, family 704, ...		Lus10038000 [exp]	223.4	0.7251

Compare expression of checked genes

Lus10005003 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.