Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G07020 111 / 2e-29 UGT80A2, SGT UDP-glucosyl transferase 80A2, sterol glucosyltransferase, UDP-Glycosyltransferase superfamily protein (.1.2) AT1G43620 91 / 4e-22 UGT80B1, TT15 TRANSPARENT TESTA 15, UDP-Glycosyltransferase superfamily protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024544 [exp] 141 / 6e-40 AT3G07020 714 / 0.0 UDP-glucosyl transferase 80A2, sterol glucosyltransferase, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10009556 [exp] 120 / 8e-33 AT3G07020 707 / 0.0 UDP-glucosyl transferase 80A2, sterol glucosyltransferase, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10020382 [exp] 110 / 4e-29 AT3G07020 790 / 0.0 UDP-glucosyl transferase 80A2, sterol glucosyltransferase, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10011882 [exp] 109 / 1e-28 AT3G07020 885 / 0.0 UDP-glucosyl transferase 80A2, sterol glucosyltransferase, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10022815 [exp] 91 / 3e-22 AT3G07020 742 / 0.0 UDP-glucosyl transferase 80A2, sterol glucosyltransferase, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10018878 [exp] 90 / 9e-22 AT1G43620 849 / 0.0 TRANSPARENT TESTA 15, UDP-Glycosyltransferase superfamily protein (.1.2.3) Lus10028572 [exp] 87 / 6e-21 AT1G43620 840 / 0.0 TRANSPARENT TESTA 15, UDP-Glycosyltransferase superfamily protein (.1.2.3) Lus10011883 [exp] 85 / 3e-20 AT3G07020 648 / 0.0 UDP-glucosyl transferase 80A2, sterol glucosyltransferase, UDP-Glycosyltransferase superfamily protein (.1.2) Lus10009557 [exp] 67 / 4e-14 AT3G07020 261 / 6e-83 UDP-glucosyl transferase 80A2, sterol glucosyltransferase, UDP-Glycosyltransferase superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G178300 [exp] 108 / 3e-28 AT3G07020 817 / 0.0 UDP-glucosyl transferase 80A2, sterol glucosyltransferase, UDP-Glycosyltransferase superfamily protein (.1.2) Potri.002G238600 [exp] 107 / 5e-28 AT3G07020 839 / 0.0 UDP-glucosyl transferase 80A2, sterol glucosyltransferase, UDP-Glycosyltransferase superfamily protein (.1.2) Potri.002G067100 [exp] 94 / 2e-23 AT1G43620 800 / 0.0 TRANSPARENT TESTA 15, UDP-Glycosyltransferase superfamily protein (.1.2.3) Potri.005G193100 [exp] 89 / 2e-21 AT1G43620 805 / 0.0 TRANSPARENT TESTA 15, UDP-Glycosyltransferase superfamily protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0113 [flax] [poplar] GT-B PF03033 [flax] [poplar] Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10005004 pacid=23182072 polypeptide=Lus10005004 locus=Lus10005004.g ID=Lus10005004.BGIv1.0 annot-version=v1.0 ATGCAGGAAGATGGTCACAGAGTTAGACTGGTCACACACGCAAATTTTAAAGATTTTGTGTTAGATGCTGGTCTCGAGTTTTTCCCTCTAGGTGGAGACG CCAAAGTTCTTGCTGCGTGTCACTGGCATGTCGTGGAGGCAATGAAAATACCGTTGCACATGTTCTTTACAATTCCCTGGACGCCAACCTGTGAATTCCC ACATCCTTTCACTCGTGTGAAGCAACCAGCTGCATACAGAATAGGAAGTCTTGGGAACCTCTTGGTCAACCTTCATGAACCTCCTACTGCTCTCTTGGAT TGGCTAGCAAGTGGTGATGCGCCCATCTACATCGGTTTCGGCAGCCTTGTGAGTTACTTCGCTAAATATTCACACCAGTGGTTTATTTAA
AA sequence Show only first row Show all	>Lus10005004 pacid=23182072 polypeptide=Lus10005004 locus=Lus10005004.g ID=Lus10005004.BGIv1.0 annot-version=v1.0 MQEDGHRVRLVTHANFKDFVLDAGLEFFPLGGDAKVLAACHWHVVEAMKIPLHMFFTIPWTPTCEFPHPFTRVKQPAAYRIGSLGNLLVNLHEPPTALLD WLASGDAPIYIGFGSLVSYFAKYSHQWFI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G43620		UGT80B1, TT15	TRANSPARENT TESTA 15, UDP-Glyc...		Lus10005004 [exp]	0	1
AT3G52120			SWAP (Suppressor-of-White-APri...		Lus10037485 [exp]	1.0	0.9140
AT5G12040			Nitrilase/cyanide hydratase an...		Lus10025012 [exp]	8.5	0.8797
					Lus10042562 [exp]	9.7	0.8623
AT5G08490		SLG1	SLOW GROWTH 1, Tetratricopepti...		Lus10014828 [exp]	9.8	0.8413
AT1G17350			NADH:ubiquinone oxidoreductase...		Lus10027384 [exp]	10.2	0.8646
AT1G19100			Histidine kinase-, DNA gyrase ...		Lus10039959 [exp]	14.3	0.8666
AT2G39580			unknown protein		Lus10005958 [exp]	15.0	0.8372
AT5G52110		CCB2, HCF208	HIGH CHLOROPHYLL FLUORESCENCE ...		Lus10005770 [exp]	17.8	0.7820
AT4G34020		AtDJ1C	DJ-1 homolog C, Class I glutam...		Lus10014067 [exp]	18.0	0.8397
AT2G24960			unknown protein		Lus10026250 [exp]	21.0	0.8350

Compare expression of checked genes

Lus10005004 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.