Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G64980 218 / 6e-73 Nucleotide-diphospho-sugar transferases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024531 [exp] 248 / 8e-85 AT1G64980 443 / 2e-159 Nucleotide-diphospho-sugar transferases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G117500 [exp] 216 / 4e-72 AT1G64980 450 / 2e-162 Nucleotide-diphospho-sugar transferases superfamily protein (.1) Potri.019G042500 [exp] 215 / 5e-72 AT1G64980 447 / 2e-161 Nucleotide-diphospho-sugar transferases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005005 pacid=23182074 polypeptide=Lus10005005 locus=Lus10005005.g ID=Lus10005005.BGIv1.0 annot-version=v1.0 ATGGATGGTGCGGTTCAGACGGTGTACCCAAGGAAGAATTGGTCTTCGATGGTGCTGTACAACTGTGGGCATCCGAAGAACAAGGTGTTAACCCCTGAGG TTGTGAATACACAGACTGGTGCTTATCTGCACAGGTTCCAGTGGCTAGAAGATGATGAAATTGGGGAAATCCCGTTTAATTGGAACTTTCTGGAGGGTCA TAACAAGGTTGTCGAAGGTGATTCGTCCACTCTCCCTAAAGCTATACATTATACCAGGGGAGGGCCGTGGTTTGATGCGTGGAAGAAGTGCGAATTTGCA GACCTATGGTTGGATGAGATGGAAGACTACATGAAGGAGACAACGAAGAAACCAAATGGGGGAACGAGTAGATTGGTTGTTTAG
AA sequence Show only first row Show all	>Lus10005005 pacid=23182074 polypeptide=Lus10005005 locus=Lus10005005.g ID=Lus10005005.BGIv1.0 annot-version=v1.0 MDGAVQTVYPRKNWSSMVLYNCGHPKNKVLTPEVVNTQTGAYLHRFQWLEDDEIGEIPFNWNFLEGHNKVVEGDSSTLPKAIHYTRGGPWFDAWKKCEFA DLWLDEMEDYMKETTKKPNGGTSRLVV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G64980			Nucleotide-diphospho-sugar tra...		Lus10005005 [exp]	0	1
AT4G08685		SAH7	Pollen Ole e 1 allergen and ex...		Lus10008615 [exp]	2.0	0.8758
					Lus10026314 [exp]	5.7	0.8561
AT1G08480		SDH6	succinate dehydrogenase 6, unk...		Lus10008448 [exp]	5.7	0.8611
AT2G02050			NADH-ubiquinone oxidoreductase...		Lus10034424 [exp]	6.7	0.8106
AT2G22170			Lipase/lipooxygenase, PLAT/LH2...		Lus10006497 [exp]	9.2	0.7859
AT5G64080		AtXYP1	xylogen protein 1, Bifunctiona...		Lus10021604 [exp]	9.5	0.8305
AT4G24805			S-adenosyl-L-methionine-depend...		Lus10013662 [exp]	9.7	0.8034
AT3G07470			Protein of unknown function, D...		Lus10039620 [exp]	10.8	0.8159
AT1G70230		AXY4, TBL27	ALTERED XYLOGLUCAN 4, TRICHOME...		Lus10010704 [exp]	11.0	0.8406
					Lus10042355 [exp]	11.2	0.8392

Compare expression of checked genes

Lus10005005 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.