Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33550 88 / 2e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G30880 74 / 1e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G32280 61 / 1e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G56480 59 / 6e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G13295 39 / 6e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019029 [exp] 145 / 5e-47 AT4G33550 106 / 7e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10019770 [exp] 72 / 8e-18 AT4G30880 98 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10016357 [exp] 66 / 1e-15 AT4G30880 94 / 4e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10019030 [exp] 66 / 2e-15 AT4G33550 79 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10005011 [exp] 64 / 8e-15 AT4G33550 78 / 1e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10027345 [exp] 63 / 2e-14 AT4G33550 81 / 1e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G049300 [exp] 85 / 6e-23 AT4G33550 81 / 6e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G023200 [exp] 83 / 2e-22 AT4G30880 115 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G023300 [exp] 82 / 5e-22 AT4G30880 99 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G048900 [exp] 70 / 3e-17 AT4G30880 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G049000 [exp] 65 / 4e-15 AT4G30880 75 / 1e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G048800 [exp] 56 / 1e-11 AT4G33550 72 / 5e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G084000 [exp] 44 / 7e-07 AT4G33550 54 / 1e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10005010 pacid=23156367 polypeptide=Lus10005010 locus=Lus10005010.g ID=Lus10005010.BGIv1.0 annot-version=v1.0 ATGTCCCTGATGTCGTGCTGGAAGTACGTCCAGAAATCCGGAGCCAAGTCTCCCCCCTCGCCCGATTGCTGCACCGCCATCAAGCCGGTTGACCTGTCCT GCGCTTGTTCCTACGTCATCAAGTCCATCGAGGGCTACGTCAACATGGATAAGGTCGTTTACGTCGCCCGCTCCTGCGGCAAGAACCTCGTCGCCGGTAC CAAGTGTGGCAGTTATACTATTCCTCCGCCGTGA
AA sequence Show only first row Show all	>Lus10005010 pacid=23156367 polypeptide=Lus10005010 locus=Lus10005010.g ID=Lus10005010.BGIv1.0 annot-version=v1.0 MSLMSCWKYVQKSGAKSPPSPDCCTAIKPVDLSCACSYVIKSIEGYVNMDKVVYVARSCGKNLVAGTKCGSYTIPPP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33550			Bifunctional inhibitor/lipid-t...		Lus10005010 [exp]	0	1
AT5G08640		ATFLS1, FLS	flavonol synthase 1 (.1.2)		Lus10025619 [exp]	2.0	0.9864
AT1G61680		ATTPS14	terpene synthase 14 (.1.2)		Lus10040632 [exp]	2.8	0.9864
AT1G18790		AtRKD1, RKD1	RWP-RK domain containing 1, RW...		Lus10019100 [exp]	3.5	0.9864
AT4G37120		SMP2	SWELLMAP 2, Pre-mRNA splicing ...		Lus10007480 [exp]	4.0	0.7911
AT2G32300		UCC1	uclacyanin 1 (.1)		Lus10007025 [exp]	4.0	0.9786
AT4G21330	bHLH	bHLH022, DYT1	DYSFUNCTIONAL TAPETUM 1, basic...		Lus10007618 [exp]	5.0	0.9580
AT1G09790		COBL6	COBRA-like protein 6 precursor...		Lus10016188 [exp]	5.5	0.9190
					Lus10000749 [exp]	7.5	0.9068
AT1G27060			Regulator of chromosome conden...		Lus10012474 [exp]	7.7	0.8147
AT4G14660		NRPE7	RNA polymerase Rpb7-like, N-te...		Lus10024251 [exp]	8.7	0.7937

Compare expression of checked genes

Lus10005010 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.