Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33550 75 / 2e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G30880 60 / 1e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G48485 42 / 4e-06 DIR1 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G56480 38 / 0.0002 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G32280 38 / 0.0002 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019030 [exp] 156 / 9e-51 AT4G33550 79 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10027345 [exp] 103 / 1e-29 AT4G33550 81 / 1e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10005010 [exp] 64 / 2e-14 AT4G33550 89 / 8e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10019029 [exp] 64 / 4e-14 AT4G33550 106 / 7e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10016357 [exp] 54 / 2e-10 AT4G30880 94 / 4e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10019770 [exp] 53 / 6e-10 AT4G30880 98 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10025866 [exp] 39 / 0.0001 AT5G48490 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10038233 [exp] 39 / 0.0002 AT5G48490 78 / 5e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10016582 [exp] 38 / 0.0003 AT5G55410 81 / 2e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G049300 [exp] 69 / 2e-16 AT4G33550 81 / 6e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.009G049000 [exp] 65 / 2e-14 AT4G30880 75 / 1e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G048900 [exp] 65 / 2e-14 AT4G30880 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G048800 [exp] 64 / 3e-14 AT4G33550 72 / 5e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G023200 [exp] 60 / 7e-13 AT4G30880 115 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G023300 [exp] 56 / 3e-11 AT4G30880 99 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G084000 [exp] 45 / 4e-07 AT4G33550 54 / 1e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.015G044500 [exp] 37 / 0.0004 AT3G18280 109 / 8e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10005011 pacid=23156358 polypeptide=Lus10005011 locus=Lus10005011.g ID=Lus10005011.BGIv1.0 annot-version=v1.0 ATGGCAATCACCGGCAAGTCATCAGCAACTTTCATCGCGGCATTGCTTGCGGCGGCGGTGGTGCTCTCGGCCCTGGTGTCAGAGGCCGACGCCGAGTGCG GAGTCAACACCGGAGACGTGCTCAGCAACTGCCAGAGCTACGTGATGAAAGGTAGGCCCAAAACGGCTCCTTCGAAGAAGTGTTGCTCCGCCTTACACGG AGCCGACGTGGCATGCGCGTGTAAGAATATGTTGACTCCGGCTATTCAGAACCTCATCGACATGGACCACGCTGTCTACGTCGGCAGGACCTGCGGCCTC AAACTCCCCGCCGGCATGAAGTGCGGCAGTAAGTAA
AA sequence Show only first row Show all	>Lus10005011 pacid=23156358 polypeptide=Lus10005011 locus=Lus10005011.g ID=Lus10005011.BGIv1.0 annot-version=v1.0 MAITGKSSATFIAALLAAAVVLSALVSEADAECGVNTGDVLSNCQSYVMKGRPKTAPSKKCCSALHGADVACACKNMLTPAIQNLIDMDHAVYVGRTCGL KLPAGMKCGSK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33550			Bifunctional inhibitor/lipid-t...		Lus10005011 [exp]	0	1
AT5G51810		AT2353, GA20OX2...	gibberellin 20 oxidase 2 (.1)		Lus10038894 [exp]	1.4	0.7956
AT2G31600			unknown protein		Lus10025558 [exp]	9.7	0.6879
AT1G26920			unknown protein		Lus10037195 [exp]	12.1	0.7575
AT1G27180			disease resistance protein (TI...		Lus10004727 [exp]	19.4	0.7566
AT5G26620			unknown protein		Lus10001512 [exp]	24.4	0.7518
AT1G11600		CYP77B1	"cytochrome P450, family 77, s...		Lus10007659 [exp]	33.5	0.7514
AT4G01570			Tetratricopeptide repeat (TPR)...		Lus10007863 [exp]	36.9	0.7339
AT3G51760			Protein of unknown function (D...		Lus10022661 [exp]	38.0	0.6945
AT3G63380			ATPase E1-E2 type family prote...		Lus10004086 [exp]	42.0	0.6907
AT3G47570			Leucine-rich repeat protein ki...		Lus10011388 [exp]	42.4	0.7290

Compare expression of checked genes

Lus10005011 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.