Lus10005014 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G20060 275 / 6e-96 UBC19 ubiquitin-conjugating enzyme19 (.1.2)
AT1G50490 268 / 3e-93 UBC20 ubiquitin-conjugating enzyme 20 (.1)
AT1G14400 128 / 4e-38 ATUBC1, UBC1 UBIQUITIN CONJUGATING ENZYME 1, ubiquitin carrier protein 1 (.1.2)
AT2G02760 128 / 4e-38 ATUBC2 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
AT5G62540 125 / 3e-37 UBC3 ubiquitin-conjugating enzyme 3 (.1)
AT1G78870 117 / 5e-34 UBC35 ,UBC13A UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3)
AT1G16890 116 / 2e-33 UBC36 ,UBC13B UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3)
AT5G56150 115 / 5e-33 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT1G64230 114 / 6e-33 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT4G27960 114 / 1e-32 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019034 325 / 2e-115 AT3G20060 292 / 1e-102 ubiquitin-conjugating enzyme19 (.1.2)
Lus10036727 129 / 2e-38 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Lus10037203 129 / 2e-38 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Lus10030786 129 / 2e-38 AT2G02760 305 / 2e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Lus10013263 127 / 9e-38 AT2G02760 304 / 6e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Lus10017654 119 / 1e-34 AT1G16890 311 / 5e-111 UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3)
Lus10033611 119 / 1e-34 AT1G16890 311 / 5e-111 UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3)
Lus10027846 116 / 2e-33 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10032352 115 / 6e-33 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G254500 297 / 2e-104 AT3G20060 295 / 1e-103 ubiquitin-conjugating enzyme19 (.1.2)
Potri.009G049600 296 / 2e-104 AT3G20060 296 / 3e-104 ubiquitin-conjugating enzyme19 (.1.2)
Potri.008G041300 215 / 5e-72 AT3G20060 223 / 7e-75 ubiquitin-conjugating enzyme19 (.1.2)
Potri.010G220600 209 / 1e-69 AT3G20060 216 / 3e-72 ubiquitin-conjugating enzyme19 (.1.2)
Potri.013G064400 129 / 2e-38 AT2G02760 313 / 1e-111 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Potri.015G064000 126 / 1e-37 AT2G02760 284 / 3e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Potri.019G039200 126 / 1e-37 AT2G02760 285 / 2e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Potri.011G111400 117 / 4e-34 AT1G78870 311 / 1e-110 UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3)
Potri.001G392500 117 / 5e-34 AT1G78870 310 / 1e-110 UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3)
Potri.001G471200 117 / 9e-34 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10005014 pacid=23156355 polypeptide=Lus10005014 locus=Lus10005014.g ID=Lus10005014.BGIv1.0 annot-version=v1.0
ATGGCTACTGTTAACGGGTACCAAGCCAACACCCCGGCAGCCACCGCGGCGTCGGCTCCTGCTCCGACTAAAAACGCCGATACTCAATCTGTGCTGAAAA
GGTTGCAGTCTGAGCTGATGGCCTTAATGATGAGTGGGGAAACTGGGATATCAGCTTTCCCAGAGGAAGACAACATCTTCTGCTGGAAAGGAACCATTAA
TGGAAGCAAAGACACAGTGTTCGAAGGGACCGAGTACAAGCTATCTTTAGCTTTCCCTAACAACTACCCGTTCAAGCCACCAAAGGTGAAGTTTGAGACC
GGCTGCTTCCATCCTAATGTCGATGTATACGGAAACATTTGCCTCGACATTCTCCAGGATAAGTGGTCATCTGCATACGATGTTCGAACTATACTGATAT
CGATTCAGAGCTTGCTTGGAGAGCCGAACATCAGTTCGCCTCTCAACAATCAAGCAGCACAACTATGGCCTAATCAGGAAGAGTATAGGAAGATGGTGGA
GAAGATGTACAAGCCTCCAACAAGTGCATAG
AA sequence
>Lus10005014 pacid=23156355 polypeptide=Lus10005014 locus=Lus10005014.g ID=Lus10005014.BGIv1.0 annot-version=v1.0
MATVNGYQANTPAATAASAPAPTKNADTQSVLKRLQSELMALMMSGETGISAFPEEDNIFCWKGTINGSKDTVFEGTEYKLSLAFPNNYPFKPPKVKFET
GCFHPNVDVYGNICLDILQDKWSSAYDVRTILISIQSLLGEPNISSPLNNQAAQLWPNQEEYRKMVEKMYKPPTSA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G20060 UBC19 ubiquitin-conjugating enzyme19... Lus10005014 0 1
AT3G20060 UBC19 ubiquitin-conjugating enzyme19... Lus10019034 1.0 0.9366
AT5G09995 unknown protein Lus10016816 4.9 0.8944
AT3G10070 TAF12, TAFII58 TATA-ASSOCIATED FACTOR II 58, ... Lus10003250 7.7 0.8894
AT3G57610 ADSS, ATPURA adenylosuccinate synthase (.1) Lus10040512 17.0 0.8826
AT5G26360 TCP-1/cpn60 chaperonin family ... Lus10034682 18.1 0.8997
AT1G75330 OTC ornithine carbamoyltransferase... Lus10033203 20.6 0.8910
AT4G00100 PFL2, ATRPS13A POINTED FIRST LEAF 2, ribosoma... Lus10027192 22.7 0.8961
AT4G25730 FtsJ-like methyltransferase fa... Lus10040439 25.2 0.8877
AT4G35890 winged-helix DNA-binding trans... Lus10025951 25.9 0.8872
AT5G55610 unknown protein Lus10004412 29.4 0.8812

Lus10005014 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.