Lus10005025 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10005025 pacid=23158821 polypeptide=Lus10005025 locus=Lus10005025.g ID=Lus10005025.BGIv1.0 annot-version=v1.0
ATGGAAAACAATCAAAATGCTATTGGGATTCAAGTTGTTGTTGAACCTCAAGTCATCCTAGCACCTCATGATGATGATGTTGTTGCTCCGACACCTCAAG
TTGATCCTGATGGACCTCAACATGCTATTATTGCTGACCCTAATGGTAATGGTGATGAGGTTATTGACACTGGAAGGTTAAAGTCAGTGCCTCTCCCTGT
TGCGATACAGTGTCTCGTTGTCTCTGTCGCTACATCTCCCAACTCTCTCTCTCTCTCGGCAGCGCCACACGCCGCCGACTCCATCCCCACCGACTCCATC
ACTGCCACTTTTCAGGCTACTCCATTCCTGCCGCCTCTCTCCGACTCAATTCCCACCGCCCTCTCTCTAACTCAAGCCCCACCGCCTCTCTTTGAATCTA
TCCCCGTTGCCTCTCTCCGAATCCAGCCCCGTCGCTTCTCTCTGAATCCTTCCCTGCCACCGCCTCAACCCAAGGTGACTACTGATCCTTTTTTATTTGT
TGATGCAAGACTTGATGATAGTTGGCTTAGTTTGATTAGCTCATGGACAATGAGCTTTTGA
AA sequence
>Lus10005025 pacid=23158821 polypeptide=Lus10005025 locus=Lus10005025.g ID=Lus10005025.BGIv1.0 annot-version=v1.0
MENNQNAIGIQVVVEPQVILAPHDDDVVAPTPQVDPDGPQHAIIADPNGNGDEVIDTGRLKSVPLPVAIQCLVVSVATSPNSLSLSAAPHAADSIPTDSI
TATFQATPFLPPLSDSIPTALSLTQAPPPLFESIPVASLRIQPRRFSLNPSLPPPQPKVTTDPFLFVDARLDDSWLSLISSWTMSF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10005025 0 1
Lus10002267 3.7 0.8229
Lus10019815 5.9 0.8475
AT1G54730 Major facilitator superfamily ... Lus10029961 10.7 0.8859
AT2G37030 SAUR-like auxin-responsive pro... Lus10026521 14.8 0.8827
AT3G14360 alpha/beta-Hydrolases superfam... Lus10037465 15.1 0.8594
AT2G36870 XTH32 xyloglucan endotransglucosylas... Lus10021422 15.7 0.8564
AT5G43120 ARM-repeat/Tetratricopeptide r... Lus10018706 16.3 0.7306
AT2G37030 SAUR-like auxin-responsive pro... Lus10013808 21.8 0.8690
AT3G47340 AT-ASN1, DIN6, ... DARK INDUCIBLE 6, ARABIDOPSIS ... Lus10042281 23.2 0.8192
AT5G06839 bZIP TGA10, bZIP65 TGACG \(TGA\) motif-binding pr... Lus10035499 31.3 0.7638

Lus10005025 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.