Lus10005041 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G58330 41 / 0.0001 ZW2 transcription factor-related (.1)
AT5G06950 40 / 0.0002 bZIP TGA2, AHBP-1B bZIP transcription factor family protein (.1.2.3.4)
AT5G06839 40 / 0.0003 bZIP TGA10, bZIP65 TGACG \(TGA\) motif-binding protein 10, bZIP transcription factor family protein (.1.2.3)
AT3G12250 39 / 0.0006 bZIP BZIP45, TGA6 TGACG motif-binding factor 6 (.1.2.3.4.5)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025265 89 / 1e-21 AT1G58330 122 / 3e-33 transcription factor-related (.1)
Lus10013746 45 / 4e-06 AT3G14880 141 / 5e-41 unknown protein
Lus10026166 41 / 9e-05 AT3G12250 514 / 0.0 TGACG motif-binding factor 6 (.1.2.3.4.5)
Lus10008658 41 / 0.0001 AT3G12250 521 / 0.0 TGACG motif-binding factor 6 (.1.2.3.4.5)
Lus10024140 40 / 0.0002 AT3G12250 532 / 0.0 TGACG motif-binding factor 6 (.1.2.3.4.5)
Lus10020610 40 / 0.0003 AT1G08320 633 / 0.0 TGACG \(TGA\) motif-binding protein 9, bZIP transcription factor family protein (.1.2.3)
Lus10042453 39 / 0.0004 AT3G14880 145 / 3e-42 unknown protein
Lus10019543 39 / 0.0006 AT1G08320 508 / 5e-178 TGACG \(TGA\) motif-binding protein 9, bZIP transcription factor family protein (.1.2.3)
Lus10026217 38 / 0.0008 AT3G14880 83 / 7e-20 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G098800 47 / 1e-06 AT3G14880 159 / 6e-48 unknown protein
Potri.003G194600 40 / 0.0002 AT3G12250 462 / 3e-162 TGACG motif-binding factor 6 (.1.2.3.4.5)
Potri.004G058200 39 / 0.0006 AT4G18650 226 / 1e-74 transcription factor-related (.1)
PFAM info
Representative CDS sequence
>Lus10005041 pacid=23149011 polypeptide=Lus10005041 locus=Lus10005041.g ID=Lus10005041.BGIv1.0 annot-version=v1.0
ATGCAGCACCACCGCCGTCCTCGGCCGCCGGCCAATACTCGAAGCAGCTCATCCTCCTTCGCCGCCGCCAATGCAGCGGACCTATTCGCCGCCTTCTTCG
ACAGCTGGCTGGTCCGTCAGCAACACTACCACGACGAGCTCCAAACCGCCGTCGATTCACGCGCCGCTCTGGACGAGGGCCACATCCGGGACCTGGTAAA
CCGGGTCCTGACCCATTACCAGCACTACTTCGAAGAGAAGTCCCGACTCGCCCACTCCGACGTCTTCATCCTCTTCTCCCCGCCGTTTCACCCTCTTCTC
CCCGCCGGGGTTCACCTCCTTGGAGCGGAGCTTCTTCTGGATCGCCGGGTTCAAGCCGGGACTAGCCTTCCGGGTCCTGCGCGATTCGGTAGGCAGCCTC
TCGCCGGAGCAGGATTGGAGCTTGTGTAA
AA sequence
>Lus10005041 pacid=23149011 polypeptide=Lus10005041 locus=Lus10005041.g ID=Lus10005041.BGIv1.0 annot-version=v1.0
MQHHRRPRPPANTRSSSSSFAAANAADLFAAFFDSWLVRQQHYHDELQTAVDSRAALDEGHIRDLVNRVLTHYQHYFEEKSRLAHSDVFILFSPPFHPLL
PAGVHLLGAELLLDRRVQAGTSLPGPARFGRQPLAGAGLELV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G58330 ZW2 transcription factor-related (... Lus10005041 0 1
AT1G53920 GLIP5 GDSL-motif lipase 5 (.1) Lus10013185 1.7 0.9095
AT1G55890 Tetratricopeptide repeat (TPR)... Lus10020073 2.4 0.9070
AT5G63450 CYP94B1 "cytochrome P450, family 94, s... Lus10014742 3.2 0.8993
AT1G62730 Terpenoid synthases superfamil... Lus10032248 3.2 0.8718
AT5G25500 unknown protein Lus10002031 3.9 0.9044
AT3G06150 unknown protein Lus10004424 4.5 0.8996
AT2G41080 Tetratricopeptide repeat (TPR)... Lus10003325 6.7 0.8727
AT2G40940 ERS1 ethylene response sensor 1 (.1... Lus10010310 7.5 0.8777
AT5G08060 unknown protein Lus10040513 8.8 0.8837
AT2G40330 RCAR9, PYL6 regulatory components of ABA r... Lus10029222 9.4 0.8706

Lus10005041 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.