Lus10005050 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G13920 40 / 0.0002 AtRLP50 receptor like protein 50 (.1)
AT1G45616 39 / 0.0006 AtRLP6 receptor like protein 6 (.1)
AT4G13820 0 / 1 Leucine-rich repeat (LRR) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002215 59 / 5e-11 AT4G20140 202 / 7e-56 GASSHO1, Leucine-rich repeat transmembrane protein kinase (.1)
Lus10003389 58 / 2e-10 AT1G45616 432 / 7e-135 receptor like protein 6 (.1)
Lus10003387 56 / 1e-09 AT1G47890 394 / 3e-120 receptor like protein 7 (.1)
Lus10042239 54 / 3e-09 AT1G45616 395 / 1e-121 receptor like protein 6 (.1)
Lus10006824 51 / 4e-08 AT3G23110 185 / 2e-50 EMBRYO DEFECTIVE 2800, receptor like protein 37 (.1)
Lus10006825 51 / 6e-08 AT1G47890 377 / 6e-114 receptor like protein 7 (.1)
Lus10004313 50 / 1e-07 AT2G33060 335 / 5e-103 receptor like protein 27 (.1)
Lus10009330 49 / 3e-07 AT1G71400 245 / 2e-69 receptor like protein 12 (.1)
Lus10024721 42 / 4e-05 AT3G23110 369 / 1e-114 EMBRYO DEFECTIVE 2800, receptor like protein 37 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G120466 57 / 1e-10 AT1G47890 73 / 4e-15 receptor like protein 7 (.1)
Potri.016G120600 49 / 2e-07 AT1G47890 441 / 7e-137 receptor like protein 7 (.1)
Potri.T125004 44 / 2e-05 AT1G45616 384 / 9e-117 receptor like protein 6 (.1)
Potri.009G112061 42 / 7e-05 AT1G45616 405 / 1e-124 receptor like protein 6 (.1)
Potri.012G029000 41 / 0.0001 AT3G05660 373 / 2e-114 receptor like protein 33 (.1)
Potri.011G104600 39 / 0.0008 AT2G15080 421 / 5e-129 receptor like protein 19 (.1.2)
PFAM info
Representative CDS sequence
>Lus10005050 pacid=23149024 polypeptide=Lus10005050 locus=Lus10005050.g ID=Lus10005050.BGIv1.0 annot-version=v1.0
ATGGCTACTTCTTATGCCATTCCTGTTCATACTAATAGGCAGCCATGTAAGCTTGGTCTTAGCACTATGCCGGGGAGACCAGTAATCGCTCCTCCTCCAA
TCGAAGCAGCGCCACCTCCTCGTTTTCAACCAATCGTTCCCCGGGAAGTTCGCTGGGTGGAACATGAGCACCGATTGCTGTACATGGCCTGGTATAACCT
TGATCGTGTCATCGGCCTAGACTTGAGTCACCAACTCATCTCCGGAGGACTTGACGATTCCATACCTCTTTTTAGACTTCAGCATCTCGAGGTCCTGGAT
TTGTCTTGGAACATCTTCAACATCACTATTCCAACTGCGCTCGCCAACCTCGCCAATTTGAAGCATTTGAACTTATCATTTGCAGTCAGGTCTCTGCTGA
TATCTCTCAGTTGA
AA sequence
>Lus10005050 pacid=23149024 polypeptide=Lus10005050 locus=Lus10005050.g ID=Lus10005050.BGIv1.0 annot-version=v1.0
MATSYAIPVHTNRQPCKLGLSTMPGRPVIAPPPIEAAPPPRFQPIVPREVRWVEHEHRLLYMAWYNLDRVIGLDLSHQLISGGLDDSIPLFRLQHLEVLD
LSWNIFNITIPTALANLANLKHLNLSFAVRSLLISLS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G45616 AtRLP6 receptor like protein 6 (.1) Lus10005050 0 1
AT1G57790 F-box family protein (.1) Lus10019204 2.0 0.8179
Lus10022112 3.6 0.8090
AT3G54700 PHT1;7 phosphate transporter 1;7 (.1) Lus10022934 4.0 0.8484
AT3G60730 Plant invertase/pectin methyle... Lus10009287 4.9 0.8150
AT1G01280 CYP703A2 "cytochrome P450, family 703, ... Lus10010119 7.3 0.8178
AT5G39130 RmlC-like cupins superfamily p... Lus10015129 8.5 0.8178
AT4G04960 Concanavalin A-like lectin pro... Lus10039837 9.5 0.8178
AT5G01180 ATPTR5 ARABIDOPSIS THALIANA PEPTIDE T... Lus10017177 10.4 0.8178
Lus10017294 11.2 0.8178
AT1G48020 ATPMEI1 ARABIDOPSIS THALIANA PECTIN ME... Lus10001658 12.0 0.8178

Lus10005050 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.