Lus10005065 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G34940 239 / 1e-76 ARO1 armadillo repeat only 1 (.1)
AT4G36030 186 / 2e-56 ARO3 armadillo repeat only 3 (.1)
AT5G66200 186 / 2e-56 ARO2 armadillo repeat only 2 (.1)
AT3G26600 97 / 4e-24 ARO4 armadillo repeat only 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027838 299 / 9e-105 AT4G34940 396 / 2e-135 armadillo repeat only 1 (.1)
Lus10027837 301 / 9e-103 AT4G34940 574 / 0.0 armadillo repeat only 1 (.1)
Lus10025059 275 / 7e-90 AT4G34940 973 / 0.0 armadillo repeat only 1 (.1)
Lus10028452 211 / 1e-65 AT5G66200 965 / 0.0 armadillo repeat only 2 (.1)
Lus10034486 195 / 1e-65 AT4G34940 163 / 2e-48 armadillo repeat only 1 (.1)
Lus10041905 210 / 3e-65 AT5G66200 966 / 0.0 armadillo repeat only 2 (.1)
Lus10037087 132 / 2e-39 AT5G66200 221 / 1e-68 armadillo repeat only 2 (.1)
Lus10036897 105 / 6e-27 AT5G66200 261 / 2e-79 armadillo repeat only 2 (.1)
Lus10026695 87 / 2e-20 AT3G26600 656 / 0.0 armadillo repeat only 4 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G172500 249 / 2e-80 AT4G34940 1020 / 0.0 armadillo repeat only 1 (.1)
Potri.009G131900 246 / 4e-79 AT4G34940 986 / 0.0 armadillo repeat only 1 (.1)
Potri.005G113000 208 / 8e-65 AT5G66200 966 / 0.0 armadillo repeat only 2 (.1)
Potri.015G082800 102 / 3e-26 AT3G26600 610 / 0.0 armadillo repeat only 4 (.1)
Potri.010G045500 100 / 1e-25 AT3G26600 632 / 0.0 armadillo repeat only 4 (.1)
PFAM info
Representative CDS sequence
>Lus10005065 pacid=23149016 polypeptide=Lus10005065 locus=Lus10005065.g ID=Lus10005065.BGIv1.0 annot-version=v1.0
ATGGGAAACCTAGCCAGAACGTTTCGAGCCACTGAGACTCGAATCGTGGGGCCCTTGGTCAAACTCCTGGACGAGAAGGAGGCAGATGTGATGATGGAAG
CTGCGATTGCCCTGAACAAGTTTGCCTCGACCGAGAACTTCCTCTGTGTGAACCACTCGAAGGCGGTGCTCGCTGGCGGAGGGACCAAACACTTGATTCA
ATTGGTCTACTTTGGGGAACAAGTGATCCAAATCCCTTCCCTAATACTCTTGTGTTACATCACCATGAATTGTCCTGATAGTGATGTTCTAGCCAATGAG
GAAGTGTTGATTGTTTTGGAATGGTCAACAAAGCAAGCCCACTTGGTGGAGAACCAAACCATCCAAGAGTTGTTGCCTGAGGCCAAAGGTAGGTTGGAGC
TTTATCAATCAAGAGGGTCAAGAGGGTTCCATTGA
AA sequence
>Lus10005065 pacid=23149016 polypeptide=Lus10005065 locus=Lus10005065.g ID=Lus10005065.BGIv1.0 annot-version=v1.0
MGNLARTFRATETRIVGPLVKLLDEKEADVMMEAAIALNKFASTENFLCVNHSKAVLAGGGTKHLIQLVYFGEQVIQIPSLILLCYITMNCPDSDVLANE
EVLIVLEWSTKQAHLVENQTIQELLPEAKGRLELYQSRGSRGFH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G34940 ARO1 armadillo repeat only 1 (.1) Lus10005065 0 1
Lus10024617 4.2 0.7270
AT5G54160 ATOMT1 O-methyltransferase 1 (.1) Lus10002667 14.2 0.6718
AT5G05340 Peroxidase superfamily protein... Lus10000626 50.1 0.6438
AT2G45120 C2H2ZnF C2H2-like zinc finger protein ... Lus10031061 61.7 0.6276
AT1G22590 MADS AGL87 AGAMOUS-like 87 (.1.2) Lus10023293 75.9 0.6006
AT1G26380 FAD-binding Berberine family p... Lus10021289 97.9 0.6079
AT4G18335 unknown protein Lus10028125 127.4 0.5923
Lus10030116 146.7 0.5780
AT1G04110 SDD1 STOMATAL DENSITY AND DISTRIBUT... Lus10007046 155.7 0.5739
AT3G25180 CYP82G1 cytochrome P450, family 82, su... Lus10016287 160.6 0.5801

Lus10005065 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.