Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G13710 148 / 3e-45 PRA1.F4 prenylated RAB acceptor 1.F4 (.1) AT1G55190 147 / 1e-44 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) AT3G13720 144 / 2e-43 PRA8, PRA1.F3 PRENYLATED RAB ACCEPTOR 1.F3, PRA1 (Prenylated rab acceptor) family protein (.1) AT1G17700 109 / 3e-30 PRA1.F1 prenylated RAB acceptor 1.F1 (.1) AT1G08770 106 / 1e-28 PRA1.E prenylated RAB acceptor 1.E (.1) AT2G38360 94 / 1e-23 PRA1.B4 prenylated RAB acceptor 1.B4 (.1) AT5G01640 91 / 2e-22 PRA1.B5 prenylated RAB acceptor 1.B5 (.1) AT1G04260 89 / 4e-22 PRA1.D, MPIP7, MPI7 PRENYLATED RAB ACCEPTOR 1.D, CAMV movement protein interacting protein 7 (.1) AT3G56110 87 / 3e-21 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2) AT5G05380 78 / 1e-17 PRA1.B3 prenylated RAB acceptor 1.B3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034363 [exp] 251 / 1e-85 AT1G55190 197 / 1e-64 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10015631 [exp] 221 / 9e-74 AT1G55190 193 / 7e-63 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10037649 [exp] 185 / 5e-60 AT1G55190 153 / 2e-47 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10014747 [exp] 98 / 2e-25 AT1G55190 147 / 9e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10033859 [exp] 97 / 8e-25 AT1G55190 149 / 1e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10021996 [exp] 95 / 5e-24 AT1G08770 162 / 3e-50 prenylated RAB acceptor 1.E (.1) Lus10026404 [exp] 90 / 4e-22 AT2G38360 253 / 5e-86 prenylated RAB acceptor 1.B4 (.1) Lus10042535 [exp] 88 / 1e-21 AT1G08770 157 / 1e-48 prenylated RAB acceptor 1.E (.1) Lus10002853 [exp] 88 / 3e-21 AT2G38360 305 / 4e-106 prenylated RAB acceptor 1.B4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G035200 [exp] 159 / 3e-49 AT1G55190 161 / 2e-50 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.005G054700 [exp] 125 / 7e-36 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1) Potri.005G219100 [exp] 113 / 2e-31 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.002G043800 [exp] 105 / 2e-28 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.002G044000 [exp] 100 / 2e-26 AT1G55190 130 / 4e-38 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.016G126400 [exp] 81 / 2e-18 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1) Potri.006G104400 [exp] 80 / 2e-18 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1) Potri.010G183300 [exp] 77 / 2e-17 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2) Potri.019G124100 [exp] 73 / 7e-16 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1) Potri.001G472300 [exp] 72 / 2e-15 AT5G56230 115 / 4e-32 prenylated RAB acceptor 1.G2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03208 [flax] [poplar] PRA1 PRA1 family protein
Representative CDS sequence Show only first row Show all	>Lus10005088 pacid=23171481 polypeptide=Lus10005088 locus=Lus10005088.g ID=Lus10005088.BGIv1.0 annot-version=v1.0 ATGACCAACTACGGAACAATCCCAATCTCCTCCTCCGCCTCCGCCGGTGCCTCTCCTTCCGAAGTCGGCGGATCCTCACCCTACTCAAACCTCGCCTACA TCTCTCGCGCCAAGGATCGCATCAAAGACGGCCTAGGCACTATGCGGCCTTGGAAATTGATGTTGGAGCTCCACAACATAGGGATCCCGGCAAACCTAGC CGATGCTCTCAGCCGCCTCAAAACCAATTCGGCCTACTTCCGGATGAACTACTCCATAATCGTGTTGGGGATCTTGTTCCTCAGCCTGCTCTGGCACCCG ATCTCGTTGATTGTGTTCATCGCCGCCATGGCGGGGTGGCTGTTCCTGTACTTCCTCAGGGATGAGCCCCTGGTTGTGTTCGGGAAGCTGATCGACGACA GCGCTGTACTCAGCTCGCTGTCGGTCGTGACGGCGGTTCTATTGTTTCTGACGGATGCTTTCTGGAATATATTGGGGTCCCTATTGGTGGGAGTAGCGGT GGTGGTGATTCACGGAGTTGCGAGAAGGACGGATGACTTGTTTTTGGATGAGGATTCAACCGGGTTCCTAGCTGCCGGCGGTGGCGGTCGATCTTCTTCT TGA
AA sequence Show only first row Show all	>Lus10005088 pacid=23171481 polypeptide=Lus10005088 locus=Lus10005088.g ID=Lus10005088.BGIv1.0 annot-version=v1.0 MTNYGTIPISSSASAGASPSEVGGSSPYSNLAYISRAKDRIKDGLGTMRPWKLMLELHNIGIPANLADALSRLKTNSAYFRMNYSIIVLGILFLSLLWHP ISLIVFIAAMAGWLFLYFLRDEPLVVFGKLIDDSAVLSSLSVVTAVLLFLTDAFWNILGSLLVGVAVVVIHGVARRTDDLFLDEDSTGFLAAGGGGRSSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G55190		PRA7, PRA1.F2	PRENYLATED RAB ACCEPTOR 1.F2, ...		Lus10005088 [exp]	0	1
AT3G11810			unknown protein		Lus10036797 [exp]	2.8	0.8938
AT4G02080		ASAR1, ATSARA1C...	secretion-associated RAS super...		Lus10010926 [exp]	5.5	0.8737
AT5G22950		VPS24.1	SNF7 family protein (.1)		Lus10021423 [exp]	5.7	0.8588
AT5G42190		SKP1B, ASK2	Arabidopsis SKP-like 2, E3 ubi...		Lus10017281 [exp]	5.9	0.8394
AT3G11780			MD-2-related lipid recognition...		Lus10013366 [exp]	9.6	0.8662
AT1G13740		AFP2	ABI five binding protein 2 (.1...		Lus10004645 [exp]	9.8	0.8149
AT3G54840		ARA6, AtRABF1, ...	Ras-related small GTP-binding ...		Lus10028820 [exp]	11.4	0.8268
AT5G14890			NHL domain-containing protein ...		Lus10033413 [exp]	13.3	0.8218
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Lus10023851 [exp]	17.7	0.8357
AT1G23050			hydroxyproline-rich glycoprote...		Lus10043476 [exp]	18.1	0.7701

Compare expression of checked genes

Lus10005088 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.