Lus10005096 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G102200 54 / 4e-09 ND /
Potri.004G112600 46 / 2e-06 ND /
PFAM info
Representative CDS sequence
>Lus10005096 pacid=23171472 polypeptide=Lus10005096 locus=Lus10005096.g ID=Lus10005096.BGIv1.0 annot-version=v1.0
ATGGTACTGCAAATGAAGTTTGTAGGGATGCTGCTGGGGCTTCTCTTCATCATGAATGCCCTGCGAGACTATTATGCTTTTGCTCACCACGATATGGAAG
TGAGAACCAATAATGATCAGATGGCGGTGCCTGCAGTTACTACTTCTGCACAAAATCATCATAAGGAACTTGGAGGAAGGAAAATGGTGGCGATGAAGAA
GAAGAAGAAAGAAGGGTATCATGCAGGCAAACATGATCAAGTGGTGAACCCTTCTGCTGCAGCAGCAGCAGCTTACTATAAGAAGGAAAGGTACAGGTGG
AAGGCGTTTAGAAAAGATGGAGAAGAAGAAGAGGAGGAGAGCAGCAATAGTAAGAGGCTAATGGAGGAAACAAGGAAGATAGTAGCTCTGATGCATAGAG
ACTACAAAGGAATGAACAAGCCTCGCCGCAAACCACCCATCAACAACCATCTCCCCATTCACTGA
AA sequence
>Lus10005096 pacid=23171472 polypeptide=Lus10005096 locus=Lus10005096.g ID=Lus10005096.BGIv1.0 annot-version=v1.0
MVLQMKFVGMLLGLLFIMNALRDYYAFAHHDMEVRTNNDQMAVPAVTTSAQNHHKELGGRKMVAMKKKKKEGYHAGKHDQVVNPSAAAAAAYYKKERYRW
KAFRKDGEEEEEESSNSKRLMEETRKIVALMHRDYKGMNKPRRKPPINNHLPIH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10005096 0 1
AT2G12646 PLATZ transcription factor fam... Lus10039989 1.0 0.9634
AT4G23430 AtTic32-IVa translocon at the inner envelo... Lus10032282 3.5 0.9487
AT2G12646 PLATZ transcription factor fam... Lus10008814 5.2 0.9438
AT3G10120 unknown protein Lus10027167 5.7 0.9393
AT5G10130 Pollen Ole e 1 allergen and ex... Lus10014332 6.3 0.9142
AT2G45240 MAP1A methionine aminopeptidase 1A (... Lus10001650 8.7 0.8961
AT2G17080 Arabidopsis protein of unknown... Lus10025120 9.2 0.9294
AT2G17080 Arabidopsis protein of unknown... Lus10025125 10.0 0.9075
AT1G05030 Major facilitator superfamily ... Lus10030010 10.4 0.9130
AT2G14210 MADS AGL44, ANR1 ARABIDOPSIS NITRATE REGULATED ... Lus10028214 10.9 0.9261

Lus10005096 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.