Lus10005105 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002194 151 / 1e-46 AT2G42360 153 / 4e-46 RING/U-box superfamily protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10005105 pacid=23171463 polypeptide=Lus10005105 locus=Lus10005105.g ID=Lus10005105.BGIv1.0 annot-version=v1.0
ATGGCGCAACCAGCTCCGGCACCGGCGTCCGTCCACTTACTCCCTCCCTTCGGCTACATCGACAGCACCGGCGTCCGTGTCTTCGATCCGTACCACATCG
AAAGGCAATACAACCTACCTCGCCGCAGCCACTCCCCTTACGACATGAACAGCAAGATCATGCTCGCCGCAATCGTTTCTCTTTCCCTCGTCAGCGCCGT
AGTCATCCTCCTCCACCTCTACGCCCGCTACGTCCTCCGCCGCCAGTACCGCCGGACCGTCTTAATCACAACCGACGGCGGGAACCGACGGCGGTGCAAC
GACGATCCCACGAAAGACCGGCCTGGACCCCACCGTGATCACTTCCCTGCCGGTCTCTGCTTACAGACAAGGGTTATCAAACGACACCGTGGAGTGTGCG
GTGTGTCTTAG
AA sequence
>Lus10005105 pacid=23171463 polypeptide=Lus10005105 locus=Lus10005105.g ID=Lus10005105.BGIv1.0 annot-version=v1.0
MAQPAPAPASVHLLPPFGYIDSTGVRVFDPYHIERQYNLPRRSHSPYDMNSKIMLAAIVSLSLVSAVVILLHLYARYVLRRQYRRTVLITTDGGNRRRCN
DDPTKDRPGPHRDHFPAGLCLQTRVIKRHRGVCGVS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G42360 RING/U-box superfamily protein... Lus10005105 0 1
AT1G08080 ATACA7, ACA7 A. THALIANA ALPHA CARBONIC ANH... Lus10021455 2.2 0.9890
Lus10024872 2.8 0.9887
AT5G44440 FAD-binding Berberine family p... Lus10012641 3.3 0.9820
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Lus10034626 6.2 0.9864
AT2G38870 Serine protease inhibitor, pot... Lus10018786 7.7 0.9863
AT3G48320 CYP71A21 "cytochrome P450, family 71, s... Lus10019460 10.8 0.9864
AT2G38870 Serine protease inhibitor, pot... Lus10018783 12.0 0.9762
AT4G08250 GRAS GRAS family transcription fact... Lus10028056 12.2 0.9802
AT4G37470 alpha/beta-Hydrolases superfam... Lus10000054 12.4 0.9445
AT2G47140 AtSDR5 short-chain dehydrogenase redu... Lus10016178 12.6 0.9709

Lus10005105 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.