Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G17190 244 / 5e-85 unknown protein AT3G03160 243 / 2e-84 unknown protein AT1G48440 102 / 6e-29 B-cell receptor-associated 31-like (.1) AT3G17780 89 / 1e-23 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034347 [exp] 263 / 1e-92 AT5G17190 246 / 5e-86 unknown protein Lus10031957 [exp] 164 / 4e-53 AT5G17190 159 / 3e-51 unknown protein Lus10040126 [exp] 89 / 1e-23 AT1G48440 191 / 3e-64 B-cell receptor-associated 31-like (.1) Lus10001080 [exp] 89 / 2e-23 AT1G48440 190 / 7e-64 B-cell receptor-associated 31-like (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G133600 [exp] 248 / 1e-86 AT5G17190 244 / 7e-85 unknown protein Potri.010G108000 [exp] 243 / 1e-84 AT5G17190 245 / 1e-85 unknown protein Potri.015G035400 [exp] 153 / 4e-49 AT3G03160 142 / 1e-44 unknown protein Potri.012G042700 [exp] 108 / 2e-31 AT1G48440 172 / 2e-56 B-cell receptor-associated 31-like (.1) Potri.015G030801 [exp] 100 / 7e-28 AT1G48440 184 / 4e-61 B-cell receptor-associated 31-like (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05529 [flax] [poplar] Bap31 Bap31/Bap29 transmembrane region
Representative CDS sequence Show only first row Show all	>Lus10005110 pacid=23171455 polypeptide=Lus10005110 locus=Lus10005110.g ID=Lus10005110.BGIv1.0 annot-version=v1.0 ATGGCACTCGAGTGGGTGGTGCTTGGATACGCAGCAGCGGCGGAGGCGATCATGGTCCTCCTCCTGACAATCCCGGGCCTCGACGGACTGCGAAAGGGAT TGATCGCCGTCACGCGCAACCTTCTGAAGCCCTTCTTGTCGGTAGTTCCGTTTTGCCTTTTCCTGTTCATGGATATCTACTGGAAGTACGAGACGCGGCC GAGTTGCGAGGGCGATTCCTGCAGCCCAAGCGAGCAGCTCCGTCACCAGAAGTCCATAATGAAGAGCCAGAGGAACGCCTTGTTGATTACGGCAGCGCTC GTCTTCTATTGGCTGCTTTACTCCGTCACCAATCTCGTCGTCAAGATCGAGCAGCTCAATGTGCGCATTGAGAGGCTCAAGAGCAAGGAGTGA
AA sequence Show only first row Show all	>Lus10005110 pacid=23171455 polypeptide=Lus10005110 locus=Lus10005110.g ID=Lus10005110.BGIv1.0 annot-version=v1.0 MALEWVVLGYAAAAEAIMVLLLTIPGLDGLRKGLIAVTRNLLKPFLSVVPFCLFLFMDIYWKYETRPSCEGDSCSPSEQLRHQKSIMKSQRNALLITAAL VFYWLLYSVTNLVVKIEQLNVRIERLKSKE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G17190			unknown protein		Lus10005110 [exp]	0	1
AT1G03350			BSD domain-containing protein ...		Lus10029636 [exp]	3.2	0.8977
AT5G39570			unknown protein		Lus10016220 [exp]	5.2	0.8991
AT1G19910		AVA-2PE, ATVHA-...	VACUOLAR-TYPE H+ ATPASE C2, AT...		Lus10028367 [exp]	5.3	0.8869
AT3G08690		ATUBC11, UBC11	ubiquitin-conjugating enzyme 1...		Lus10009422 [exp]	8.2	0.8920
AT1G65720			unknown protein		Lus10031363 [exp]	8.5	0.8942
AT3G02720			Class I glutamine amidotransfe...		Lus10010964 [exp]	10.0	0.8585
AT3G55530		SDIR1	SALT- AND DROUGHT-INDUCED RING...		Lus10001568 [exp]	11.2	0.8873
AT1G79550		PGK	phosphoglycerate kinase (.1.2)		Lus10031167 [exp]	12.7	0.8814
AT1G04635		EMB1687	EMBRYO DEFECTIVE 1687, ribonuc...		Lus10032961 [exp]	13.0	0.7869
AT4G29680			Alkaline-phosphatase-like fami...		Lus10032681 [exp]	13.6	0.8916

Compare expression of checked genes

Lus10005110 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.