Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018826 [exp] 42 / 1e-05 AT4G23470 328 / 2e-113 PLAC8 family protein (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G101100 [exp] 39 / 6e-05 AT1G63830 353 / 2e-124 PLAC8 family protein (.1.2.3) Potri.014G087600 [exp] 38 / 0.0002 AT5G41390 327 / 8e-114 PLAC8 family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005117 pacid=23153403 polypeptide=Lus10005117 locus=Lus10005117.g ID=Lus10005117.BGIv1.0 annot-version=v1.0 ATGGATAAAAGAGACGGCAAGTACGGGCCTCCGCCAGCGATGGCAGTGCCTCCAGCACAGCAGATGTCGCGGATTAACCAGCGGATACCACCTTCTCCAA ACTATCCACCTCGTGACGACAACTTCAAGGCCAGTGATCATCAACCCTCACATTATCCGGGAGCAGGATATCCATCAGGGTCGTACCCTCCCCCACCACC ACCAGGATATTGTTGA
AA sequence Show only first row Show all	>Lus10005117 pacid=23153403 polypeptide=Lus10005117 locus=Lus10005117.g ID=Lus10005117.BGIv1.0 annot-version=v1.0 MDKRDGKYGPPPAMAVPPAQQMSRINQRIPPSPNYPPRDDNFKASDHQPSHYPGAGYPSGSYPPPPPPGYC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G23470			PLAC8 family protein (.1.2.3)		Lus10005117 [exp]	0	1
AT1G56580		SVB	SMALLER WITH VARIABLE BRANCHES...		Lus10033613 [exp]	1.4	0.8090
					Lus10003693 [exp]	4.5	0.7782
AT1G10010		AAP8, ATAAP8	amino acid permease 8 (.1)		Lus10037248 [exp]	6.2	0.8379
AT5G35390			Leucine-rich repeat protein ki...		Lus10017144 [exp]	6.3	0.7287
AT1G35710			Protein kinase family protein ...		Lus10002293 [exp]	13.0	0.6859
AT5G64030			S-adenosyl-L-methionine-depend...		Lus10000839 [exp]	14.1	0.7810
AT5G59790			Domain of unknown function (DU...		Lus10030328 [exp]	16.3	0.6310
AT3G05950			RmlC-like cupins superfamily p...		Lus10015128 [exp]	18.0	0.7820
AT4G16260			Glycosyl hydrolase superfamily...		Lus10027479 [exp]	22.1	0.5764
AT2G28720			Histone superfamily protein (....		Lus10025313 [exp]	22.6	0.7696

Compare expression of checked genes

Lus10005117 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.