Lus10005118 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G33340 158 / 4e-47 CDR1 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
AT1G64830 157 / 7e-47 Eukaryotic aspartyl protease family protein (.1)
AT1G31450 148 / 3e-43 Eukaryotic aspartyl protease family protein (.1)
AT2G35615 147 / 7e-43 Eukaryotic aspartyl protease family protein (.1)
AT3G61820 110 / 6e-29 Eukaryotic aspartyl protease family protein (.1)
AT3G18490 109 / 1e-28 Eukaryotic aspartyl protease family protein (.1)
AT1G01300 108 / 2e-28 Eukaryotic aspartyl protease family protein (.1)
AT3G20015 107 / 5e-28 Eukaryotic aspartyl protease family protein (.1)
AT2G28010 107 / 6e-28 Eukaryotic aspartyl protease family protein (.1)
AT2G28040 103 / 9e-27 Eukaryotic aspartyl protease family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018825 247 / 2e-81 AT5G33340 432 / 1e-149 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Lus10022912 196 / 1e-61 AT5G33340 450 / 1e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Lus10024903 196 / 2e-61 AT5G33340 449 / 3e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Lus10024910 192 / 7e-60 AT5G33340 452 / 2e-157 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Lus10041150 187 / 8e-59 AT5G33340 399 / 2e-137 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Lus10041151 187 / 3e-58 AT5G33340 445 / 1e-154 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Lus10040325 187 / 3e-58 AT5G33340 451 / 5e-157 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Lus10023445 186 / 9e-58 AT5G33340 448 / 9e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Lus10002613 176 / 6e-54 AT5G33340 406 / 4e-139 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G114400 150 / 4e-44 AT5G33340 475 / 1e-166 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Potri.003G087900 148 / 2e-43 AT5G33340 430 / 8e-149 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Potri.003G105300 124 / 3e-34 AT2G35615 414 / 2e-142 Eukaryotic aspartyl protease family protein (.1)
Potri.007G106300 115 / 9e-31 AT3G20015 575 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Potri.002G171700 112 / 8e-30 AT1G01300 642 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Potri.005G063000 112 / 1e-29 AT3G20015 560 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Potri.014G099400 109 / 1e-28 AT1G01300 633 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Potri.010G128200 105 / 4e-27 AT1G25510 622 / 0.0 Eukaryotic aspartyl protease family protein (.1)
Potri.006G232600 102 / 6e-26 AT5G10770 438 / 1e-150 Eukaryotic aspartyl protease family protein (.1)
Potri.006G232400 101 / 9e-26 AT5G10770 418 / 4e-143 Eukaryotic aspartyl protease family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0129 Peptidase_AA PF00026 Asp Eukaryotic aspartyl protease
Representative CDS sequence
>Lus10005118 pacid=23153415 polypeptide=Lus10005118 locus=Lus10005118.g ID=Lus10005118.BGIv1.0 annot-version=v1.0
ATGAACATCTCCCTCGGGACACCCCCAGTTCCAATCCTGGCCATCGCCGACACTGGAAGCGACATCGTATGGACACAATGCAAGCCTTGCCCCAGCTGTT
ACATGCAGAATGCTCCCTTGTTCAACCCTGCCTCTTCACGAACCTACAAAATGGTGTCGTGCTCATCCAACACATGTTCTTCCCTACGTGACGAAGGAGC
CTTCTGCTCTGAAAACGACGCTGTTTGCCATTACCAGGTTGGATATGGAGACCAGTCCCACACGGACGGTGACTTGGCACTTGAAACGTTGACTCTACAG
TCAATCTCGAGTGGTTCTGTGTCATTTAACAAGACGTTGATGGGATGTGGCCACAATAATGCTGGAACGTTCAATGCTAATGGTTCGGGGATCGTCGGGT
TAGGAGGTGGATCCGCTTCTCTGATTACCCAAATCGGCTCATCAATTGGCTATAAATTTTCTACTGCTTAG
AA sequence
>Lus10005118 pacid=23153415 polypeptide=Lus10005118 locus=Lus10005118.g ID=Lus10005118.BGIv1.0 annot-version=v1.0
MNISLGTPPVPILAIADTGSDIVWTQCKPCPSCYMQNAPLFNPASSRTYKMVSCSSNTCSSLRDEGAFCSENDAVCHYQVGYGDQSHTDGDLALETLTLQ
SISSGSVSFNKTLMGCGHNNAGTFNANGSGIVGLGGGSASLITQIGSSIGYKFSTA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10005118 0 1

Lus10005118 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.