Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G01250 63 / 4e-13 WRKY ATWRKY22, WRKY22 WRKY family transcription factor (.1) AT1G30650 60 / 6e-12 WRKY ATWRKY14, AR411, WRKY14 WRKY DNA-binding protein 14 (.1) AT2G34830 57 / 7e-11 WRKY ATWRKY35, WRKY35, MEE24 maternal effect embryo arrest 24, WRKY DNA-binding protein 35 (.1) AT5G52830 56 / 2e-10 WRKY ATWRKY27, WRKY27 ARABIDOPSIS THALIANA WRKY DNA-BINDING PROTEIN 27, WRKY DNA-binding protein 27 (.1) AT4G23550 55 / 3e-10 WRKY ATWRKY29, WRKY29 WRKY family transcription factor (.1) AT1G29280 54 / 4e-10 WRKY ATWRKY65, WRKY65 WRKY DNA-binding protein 65 (.1) AT3G58710 49 / 2e-08 WRKY ATWRKY69, WRKY69 RABIDOPSIS THALIANA WRKY DNA-BINDING PROTEIN 69, WRKY DNA-binding protein 69 (.1.2) AT5G45050 49 / 5e-08 WRKY ATWRKY16, TTR1 TOLERANT TO TOBACCO RINGSPOT NEPOVIRUS 1, Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2) AT2G30590 44 / 1e-06 WRKY WRKY21 WRKY DNA-binding protein 21 (.1) AT4G31550 44 / 2e-06 WRKY ATWRKY11, WRKY11 WRKY DNA-binding protein 11 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005132 [exp] 94 / 2e-26 AT4G01250 72 / 1e-15 WRKY family transcription factor (.1) Lus10018815 [exp] 64 / 2e-13 AT4G01250 149 / 4e-41 WRKY family transcription factor (.1) Lus10036399 [exp] 63 / 2e-13 AT4G01250 207 / 2e-66 WRKY family transcription factor (.1) Lus10007907 [exp] 63 / 5e-13 AT4G01250 228 / 2e-72 WRKY family transcription factor (.1) Lus10038426 [exp] 58 / 2e-11 AT2G34830 252 / 1e-81 maternal effect embryo arrest 24, WRKY DNA-binding protein 35 (.1) Lus10007305 [exp] 56 / 5e-11 AT1G29280 164 / 9e-51 WRKY DNA-binding protein 65 (.1) Lus10029252 [exp] 56 / 9e-11 AT1G29280 166 / 9e-51 WRKY DNA-binding protein 65 (.1) Lus10005428 [exp] 52 / 3e-09 AT1G29280 194 / 1e-61 WRKY DNA-binding protein 65 (.1) Lus10039295 [exp] 50 / 2e-08 AT5G52830 170 / 4e-50 ARABIDOPSIS THALIANA WRKY DNA-BINDING PROTEIN 27, WRKY DNA-binding protein 27 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G164400 [exp] 63 / 5e-13 AT4G01250 244 / 4e-79 WRKY family transcription factor (.1) Potri.014G090300 [exp] 61 / 2e-12 AT4G01250 250 / 1e-81 WRKY family transcription factor (.1) Potri.004G060900 [exp] 57 / 3e-11 AT1G29280 247 / 3e-82 WRKY DNA-binding protein 65 (.1) Potri.001G460600 [exp] 57 / 4e-11 AT1G30650 322 / 2e-106 WRKY DNA-binding protein 14 (.1) Potri.011G070100 [exp] 56 / 7e-11 AT1G29280 237 / 3e-78 WRKY DNA-binding protein 65 (.1) Potri.011G157100 [exp] 56 / 1e-10 AT1G30650 305 / 1e-99 WRKY DNA-binding protein 14 (.1) Potri.001G099001 [exp] 53 / 1e-09 AT4G01250 138 / 2e-38 WRKY family transcription factor (.1) Potri.017G149000 [exp] 53 / 2e-09 AT5G52830 192 / 2e-57 ARABIDOPSIS THALIANA WRKY DNA-BINDING PROTEIN 27, WRKY DNA-binding protein 27 (.1) Potri.004G072000 [exp] 52 / 3e-09 AT5G52830 182 / 2e-53 ARABIDOPSIS THALIANA WRKY DNA-BINDING PROTEIN 27, WRKY DNA-binding protein 27 (.1) Potri.003G132700 [exp] 51 / 5e-09 AT4G01250 121 / 5e-32 WRKY family transcription factor (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0274 [flax] [poplar] WRKY-GCM1 PF03106 [flax] [poplar] WRKY WRKY DNA -binding domain
Representative CDS sequence Show only first row Show all	>Lus10005131 pacid=23153397 polypeptide=Lus10005131 locus=Lus10005131.g ID=Lus10005131.BGIv1.0 annot-version=v1.0 ATGGCGAGGAAGCAAGTAGAGAGGAACAAATTCGACCCGGAAATGTTCGTCGTCACCTACACGGAGGAGCACAACGAACACCCCCCTGGCCACCACAACT GCCTCGCCGGAACCACCCGCCAGAACAACAAGGGATATTACAGATGTAGCTCCTCAAAAACATGTATGGTGAGGAAGCAAGTAGAGAGGAACAAATTCGA CCCGGAAATGTTCGTCGTCACCTACACGGAGGAGCACAACCACCACCACCCTGACCACCACAGTTGA
AA sequence Show only first row Show all	>Lus10005131 pacid=23153397 polypeptide=Lus10005131 locus=Lus10005131.g ID=Lus10005131.BGIv1.0 annot-version=v1.0 MARKQVERNKFDPEMFVVTYTEEHNEHPPGHHNCLAGTTRQNNKGYYRCSSSKTCMVRKQVERNKFDPEMFVVTYTEEHNHHHPDHHS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G29280	WRKY	ATWRKY65, WRKY6...	WRKY DNA-binding protein 65 (....		Lus10005131 [exp]	0	1

Compare expression of checked genes

Lus10005131 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.