Lus10005140 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G11650 117 / 6e-33 ATOSM34 osmotin 34 (.1)
AT1G77700 84 / 2e-19 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G20030 79 / 1e-17 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT4G36010 78 / 3e-17 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT1G75040 75 / 1e-16 PR-5, PR5 pathogenesis-related gene 5 (.1)
AT1G19320 74 / 2e-16 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G75050 73 / 8e-16 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G75800 73 / 2e-15 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G75030 72 / 2e-15 ATLP-3 thaumatin-like protein 3 (.1)
AT4G24180 72 / 2e-15 ATTLP1 THAUMATIN-LIKE PROTEIN 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017170 166 / 5e-52 AT4G11650 251 / 2e-84 osmotin 34 (.1)
Lus10007034 146 / 7e-44 AT4G11650 293 / 5e-101 osmotin 34 (.1)
Lus10006302 143 / 5e-43 AT4G11650 294 / 3e-101 osmotin 34 (.1)
Lus10006690 142 / 2e-42 AT4G11650 292 / 1e-100 osmotin 34 (.1)
Lus10024511 124 / 5e-35 AT4G11650 315 / 5e-109 osmotin 34 (.1)
Lus10037483 83 / 5e-19 AT1G75030 242 / 3e-79 thaumatin-like protein 3 (.1)
Lus10015705 80 / 2e-18 AT1G75030 256 / 6e-86 thaumatin-like protein 3 (.1)
Lus10025629 81 / 4e-18 AT1G77700 377 / 4e-130 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10023897 79 / 5e-18 AT1G75800 271 / 8e-91 Pathogenesis-related thaumatin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G107800 141 / 3e-42 AT4G11650 291 / 1e-100 osmotin 34 (.1)
Potri.001G107950 140 / 5e-42 AT4G11650 287 / 6e-99 osmotin 34 (.1)
Potri.001G107600 129 / 2e-37 AT4G11650 356 / 1e-125 osmotin 34 (.1)
Potri.001G102400 125 / 9e-36 AT4G11650 360 / 2e-127 osmotin 34 (.1)
Potri.018G096063 117 / 5e-33 AT4G11650 314 / 2e-109 osmotin 34 (.1)
Potri.002G087100 81 / 2e-18 AT1G77700 384 / 2e-134 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.003G020100 80 / 5e-18 AT1G77700 274 / 1e-90 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.011G003900 81 / 8e-18 AT5G38280 413 / 1e-135 PR5-like receptor kinase (.1)
Potri.005G173900 79 / 9e-18 AT1G77700 316 / 2e-107 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.005G112600 76 / 2e-16 AT4G38660 348 / 2e-119 Pathogenesis-related thaumatin superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0293 CDC PF00314 Thaumatin Thaumatin family
Representative CDS sequence
>Lus10005140 pacid=23141917 polypeptide=Lus10005140 locus=Lus10005140.g ID=Lus10005140.BGIv1.0 annot-version=v1.0
ATGTCCCTCAGGGACCACCGGAGGCTGAATATGGGCCCGCAACGGCTGCCAGTTCAATGGTGCACAGGGCGGTGCCATACTGGCGACTGCGGAGGCCTCC
TTGAGTGTAAAGACTACGGTGCTGCTCCCAACACCTTGGCCGAGTTCGCGTTGAACCAGTTCAGTGGCTTGGATTACATCGATATCTCGCTGGTCGACGG
GTTCAACGTGTTGAGGTTCAGCGGCTTGGATTACATCGATATCTCGCTGGTCGACGGGTTCAACGTGCCAGTAATGTTGAGCTCGGCATCCCCGGCCAGC
TGCGGGACGGTGATGAGGTGCAGGGGTGATATCATAAGACAGGAGCGTCCAAATGCGCTCAGAGTTGACGGAGGTTGCAATGGGGCTTGTCCGCAGTTGA
AGAGAGACGAGTACTGTTGCCCCAACAGATACAAAGGCGTACATTGCGGGCCTACAGATTTCTCAAGGTATTTCAAGGATGGGTGCTATGATGCTTATAG
TTGCCCCGCAGTTGACCCAACCAGCGTCATCTTTTTGTTGGACCGTTATTGA
AA sequence
>Lus10005140 pacid=23141917 polypeptide=Lus10005140 locus=Lus10005140.g ID=Lus10005140.BGIv1.0 annot-version=v1.0
MSLRDHRRLNMGPQRLPVQWCTGRCHTGDCGGLLECKDYGAAPNTLAEFALNQFSGLDYIDISLVDGFNVLRFSGLDYIDISLVDGFNVPVMLSSASPAS
CGTVMRCRGDIIRQERPNALRVDGGCNGACPQLKRDEYCCPNRYKGVHCGPTDFSRYFKDGCYDAYSCPAVDPTSVIFLLDRY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G11650 ATOSM34 osmotin 34 (.1) Lus10005140 0 1
Lus10035046 4.8 0.8568
Lus10011725 10.3 0.8092
AT1G68470 Exostosin family protein (.1) Lus10005566 18.1 0.7955
AT1G33930 P-loop containing nucleoside t... Lus10003507 20.2 0.6939
AT4G34760 SAUR-like auxin-responsive pro... Lus10012189 21.4 0.7869
AT4G28080 Tetratricopeptide repeat (TPR)... Lus10036604 23.9 0.7904
Lus10012497 24.7 0.7277
AT5G42905 Polynucleotidyl transferase, r... Lus10034950 37.1 0.7547
AT5G36930 Disease resistance protein (TI... Lus10042165 45.2 0.7890
AT4G28080 Tetratricopeptide repeat (TPR)... Lus10035822 51.9 0.7764

Lus10005140 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.