Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41540 48 / 2e-07 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G27170 48 / 2e-07 transmembrane receptors;ATP binding (.1.2) AT5G17680 47 / 3e-07 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT4G12010 47 / 3e-07 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G65850 47 / 4e-07 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT5G41550 47 / 6e-07 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G45220 46 / 6e-07 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G09665 45 / 6e-07 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT4G16990 46 / 1e-06 RLM3 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative AT4G09430 45 / 1e-06 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026845 [exp] 109 / 2e-30 AT5G36930 145 / 8e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10041606 [exp] 103 / 8e-28 AT5G36930 140 / 5e-37 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10027920 [exp] 91 / 6e-23 AT5G36930 139 / 3e-36 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10012063 [exp] 86 / 1e-21 AT5G36930 124 / 5e-34 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10041605 [exp] 81 / 4e-20 AT1G72940 93 / 3e-22 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) Lus10004482 [exp] 59 / 2e-11 AT1G56540 111 / 2e-27 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10029919 [exp] 58 / 3e-11 AT5G36930 105 / 5e-26 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10029921 [exp] 54 / 2e-09 AT5G36930 105 / 7e-26 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10019142 [exp] 51 / 2e-08 AT1G72890 140 / 1e-36 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G097050 [exp] 54 / 4e-10 AT5G36930 158 / 3e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G019710 [exp] 55 / 7e-10 AT5G36930 445 / 2e-144 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G069200 [exp] 55 / 7e-10 AT5G17680 590 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.005G206400 [exp] 54 / 1e-09 AT5G36930 587 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T126506 [exp] 54 / 2e-09 AT3G14470 575 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Potri.019G003285 [exp] 54 / 2e-09 AT5G36930 640 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G003942 [exp] 53 / 3e-09 AT5G36930 591 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.005G004233 [exp] 52 / 3e-09 AT1G27170 153 / 8e-42 transmembrane receptors;ATP binding (.1.2) Potri.013G098100 [exp] 52 / 3e-09 AT5G36930 159 / 1e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T126306 [exp] 52 / 5e-09 AT3G14470 585 / 0.0 NB-ARC domain-containing disease resistance protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10005174 pacid=23163366 polypeptide=Lus10005174 locus=Lus10005174.g ID=Lus10005174.BGIv1.0 annot-version=v1.0 ATGTCAATCCTGGTTCTCTCGAGGGGATACGCCTCCTCGAAGTGGTGTTTGGACGAGCTGGTGAAGATCATGGAGGCCGCCAATGACAAGGCTCGTCTCC ACCAGCCTTTCCCTTTTTTCTACAAAGTGTCCGATCAGTCATCGGGGTGCGACAAGGAAGACTTCGATATGCACAAGAGAAGGTTCAGCTACACGCAAAT TGGTCGAATGCAGCAGGAATCGACCGGCGACAAACGCACCTGTTACCAAACCTGCAACGCCGCCGAGTTCTTGTCCGCGGTCTGCCATCGTCCCCGAATC GCGGGTGTCTTCCGCATGTTGATCGGATAA
AA sequence Show only first row Show all	>Lus10005174 pacid=23163366 polypeptide=Lus10005174 locus=Lus10005174.g ID=Lus10005174.BGIv1.0 annot-version=v1.0 MSILVLSRGYASSKWCLDELVKIMEAANDKARLHQPFPFFYKVSDQSSGCDKEDFDMHKRRFSYTQIGRMQQESTGDKRTCYQTCNAAEFLSAVCHRPRI AGVFRMLIG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G17680			disease resistance protein (TI...		Lus10005174 [exp]	0	1
					Lus10022997 [exp]	1.0	0.8559
					Lus10018990 [exp]	2.0	0.8401
AT1G05385		Psb27-H1, LPA19	LOW PSII ACCUMULATION 19, phot...		Lus10010561 [exp]	4.4	0.7933
AT4G38380			MATE efflux family protein (.1...		Lus10020203 [exp]	4.9	0.8501
					Lus10019515 [exp]	11.4	0.8407
AT1G76140			Prolyl oligopeptidase family p...		Lus10021835 [exp]	11.5	0.7702
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10035637 [exp]	14.4	0.8228
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10029570 [exp]	14.7	0.8389
AT2G40435			unknown protein		Lus10017415 [exp]	15.2	0.8257
AT2G40920			F-box and associated interacti...		Lus10020082 [exp]	15.5	0.7987

Compare expression of checked genes

Lus10005174 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.