Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14450 101 / 3e-30 NADH dehydrogenase (ubiquinone)s (.1) AT2G02510 99 / 2e-29 NADH dehydrogenase (ubiquinone)s (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038124 [exp] 113 / 7e-35 AT1G14450 112 / 1e-34 NADH dehydrogenase (ubiquinone)s (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G229900 [exp] 100 / 6e-30 AT1G14450 104 / 1e-31 NADH dehydrogenase (ubiquinone)s (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08122 [flax] [poplar] NDUF_B12 NADH-ubiquinone oxidoreductase B12 subunit family
Representative CDS sequence Show only first row Show all	>Lus10005182 pacid=23163373 polypeptide=Lus10005182 locus=Lus10005182.g ID=Lus10005182.BGIv1.0 annot-version=v1.0 ATGGGAAAGCCGTTGGGAACAACAGGAGAATTCTTCCGGCGAAGGGATGCATGGAGGAAGCATCCCATGCTCACCAATCAGTTCCGCCACGCCCTTCCCG GATTTGGCATCGGCGTTACCGCCTTCGCTGTCTATGTCATCGGCGAGCAAATCTACAATAGGATTGGCGCCCCTTCCTCTCACGGCGCCTCCTCCTCCTC TGCATCTCACTCTCACTGA
AA sequence Show only first row Show all	>Lus10005182 pacid=23163373 polypeptide=Lus10005182 locus=Lus10005182.g ID=Lus10005182.BGIv1.0 annot-version=v1.0 MGKPLGTTGEFFRRRDAWRKHPMLTNQFRHALPGFGIGVTAFAVYVIGEQIYNRIGAPSSHGASSSSASHSH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G02510			NADH dehydrogenase (ubiquinone...		Lus10005182 [exp]	0	1
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Lus10032561 [exp]	2.6	0.8135
AT4G13520		SMAP1	small acidic protein 1 (.1)		Lus10023702 [exp]	4.7	0.7741
AT2G25720			unknown protein		Lus10032479 [exp]	6.3	0.7676
AT5G44170			S-adenosyl-L-methionine-depend...		Lus10018640 [exp]	6.7	0.7725
AT3G58110			unknown protein		Lus10002186 [exp]	7.5	0.7636
AT2G34585			unknown protein		Lus10023307 [exp]	8.0	0.7618
AT3G17120			unknown protein		Lus10010906 [exp]	8.2	0.7400
AT5G24165			unknown protein		Lus10014921 [exp]	10.5	0.7492
AT5G62200			Embryo-specific protein 3, (AT...		Lus10031684 [exp]	11.8	0.7660
AT5G62030			diphthamide synthesis DPH2 fam...		Lus10039108 [exp]	12.0	0.7580

Compare expression of checked genes

Lus10005182 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.