Lus10005183 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G19110 176 / 3e-54 Protein kinase superfamily protein (.1.2.3)
AT5G45430 168 / 8e-51 Protein kinase superfamily protein (.1.2)
AT4G13020 118 / 2e-32 MHK Protein kinase superfamily protein (.1.2.3.4.5)
AT1G53570 61 / 1e-11 MAPKKK3, MAP3KA MAP KINASE KINASE KINASE 3, mitogen-activated protein kinase kinase kinase 3 (.1.2.3.4.5)
AT1G01560 55 / 1e-09 ATMPK11 MAP kinase 11 (.1.2)
AT4G11330 53 / 8e-09 ATMPK5 MAP kinase 5 (.1)
AT4G26890 53 / 9e-09 MAPKKK16 mitogen-activated protein kinase kinase kinase 16 (.1)
AT4G12020 52 / 1e-08 WRKY MEKK4, MAPKKK11, ATWRKY19, WRKY19 MAPK/ERK KINASE KINASE 4, MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 11, protein kinase family protein (.1.2.3)
AT4G36450 52 / 1e-08 ATMPK14 mitogen-activated protein kinase 14 (.1)
AT5G63370 52 / 2e-08 CDKG;1 Protein kinase superfamily protein (.1.2.3.4)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038123 204 / 3e-64 AT4G19110 555 / 0.0 Protein kinase superfamily protein (.1.2.3)
Lus10008303 181 / 2e-55 AT4G19110 616 / 0.0 Protein kinase superfamily protein (.1.2.3)
Lus10033278 175 / 4e-53 AT4G19110 620 / 0.0 Protein kinase superfamily protein (.1.2.3)
Lus10003155 119 / 2e-32 AT4G13020 629 / 0.0 Protein kinase superfamily protein (.1.2.3.4.5)
Lus10007921 55 / 2e-09 AT4G01370 689 / 0.0 MAP kinase 4 (.1)
Lus10036384 54 / 3e-09 AT4G01370 681 / 0.0 MAP kinase 4 (.1)
Lus10017518 54 / 3e-09 AT4G01370 632 / 0.0 MAP kinase 4 (.1)
Lus10028765 54 / 4e-09 AT4G01370 630 / 0.0 MAP kinase 4 (.1)
Lus10038858 54 / 5e-09 AT1G63700 668 / 0.0 YODA, MAP KINASE KINASE KINASE 4, EMBRYO DEFECTIVE 71, Protein kinase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G101600 183 / 1e-56 AT4G19110 689 / 0.0 Protein kinase superfamily protein (.1.2.3)
Potri.003G190200 144 / 4e-42 AT4G19110 508 / 5e-179 Protein kinase superfamily protein (.1.2.3)
Potri.010G154400 140 / 2e-41 AT4G19110 451 / 4e-158 Protein kinase superfamily protein (.1.2.3)
Potri.016G012801 140 / 5e-41 AT4G19110 452 / 3e-158 Protein kinase superfamily protein (.1.2.3)
Potri.001G035400 122 / 2e-35 AT4G19110 306 / 9e-104 Protein kinase superfamily protein (.1.2.3)
Potri.002G247500 115 / 2e-31 AT4G13020 629 / 0.0 Protein kinase superfamily protein (.1.2.3.4.5)
Potri.014G088500 54 / 4e-09 AT4G01370 676 / 0.0 MAP kinase 4 (.1)
Potri.002G003400 53 / 9e-09 AT1G76540 553 / 0.0 cyclin-dependent kinase B2;1 (.1)
Potri.018G083300 52 / 2e-08 AT4G28980 640 / 0.0 CYCLIN-DEPENDENT KINASE F;1, CDK-activating kinase 1AT (.1.2)
Potri.009G066100 51 / 3e-08 AT3G45640 652 / 0.0 mitogen-activated protein kinase 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF00069 Pkinase Protein kinase domain
Representative CDS sequence
>Lus10005183 pacid=23163360 polypeptide=Lus10005183 locus=Lus10005183.g ID=Lus10005183.BGIv1.0 annot-version=v1.0
ATGCAAGAAGTTGGTGATGGAGCATTTGGGACCGTCTGGCGAGCAATAAACAAGCAGACGGGTGAAGTTGAATGCAACTTGTACCATCTGATCAAAGATA
GGTCTAAGCTATTCTCAGAAGCTGAAATCAGAGATTGGTGTTTTCAAATATTTCAAGGTCTAGCTTATATGCATCAGCGTGGCTACTTTCATCGTGATCT
AAAGCCTGATATCTGGGCAATGGGTGCCATAATGGCTGAATTATTTACCCTCAGGCCTCTTTTTCCCGGTACCAGTTTCCCGGCGTGCACCTCTCTGATA
CCATCAGCAAGTGATGATGCGATAAATCTTATTACATCTCTCTGTATGTGGGATCCAAGCAAAAGGCCAACAGCTGCAGAGGCACTTCAGCATCCTTTCT
TCCAAGCGGTGAGGGTTCAGCTCTGA
AA sequence
>Lus10005183 pacid=23163360 polypeptide=Lus10005183 locus=Lus10005183.g ID=Lus10005183.BGIv1.0 annot-version=v1.0
MQEVGDGAFGTVWRAINKQTGEVECNLYHLIKDRSKLFSEAEIRDWCFQIFQGLAYMHQRGYFHRDLKPDIWAMGAIMAELFTLRPLFPGTSFPACTSLI
PSASDDAINLITSLCMWDPSKRPTAAEALQHPFFQAVRVQL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G19110 Protein kinase superfamily pro... Lus10005183 0 1
AT3G48470 EMB2423 embryo defective 2423 (.1) Lus10001101 16.3 0.8044
AT1G50030 TOR target of rapamycin (.1.2) Lus10037246 29.4 0.7831
Lus10031222 38.2 0.7152
AT5G06560 Protein of unknown function, D... Lus10015990 38.6 0.7452
AT3G19190 ATATG2 autophagy 2 (.1) Lus10019868 41.7 0.7757
AT2G14255 Ankyrin repeat family protein ... Lus10000132 46.3 0.7093
AT3G04490 unknown protein Lus10022024 48.0 0.7665
Lus10001309 51.1 0.7614
AT3G46960 RNA helicase, ATP-dependent, S... Lus10002528 58.5 0.7553
AT1G58230 binding (.1) Lus10042866 62.0 0.7598

Lus10005183 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.