Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G10230 132 / 2e-38 AtLCY, LYC lycopene cyclase (.1.2) AT5G57030 73 / 2e-16 LUT2 LUTEIN DEFICIENT 2, Lycopene beta/epsilon cyclase protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013298 [exp] 204 / 9e-65 AT3G10230 508 / 3e-177 lycopene cyclase (.1.2) Lus10027278 [exp] 128 / 5e-36 AT3G10230 832 / 0.0 lycopene cyclase (.1.2) Lus10038986 [exp] 127 / 6e-36 AT3G10230 831 / 0.0 lycopene cyclase (.1.2) Lus10000221 [exp] 76 / 2e-18 AT5G57030 251 / 9e-82 LUTEIN DEFICIENT 2, Lycopene beta/epsilon cyclase protein (.1) Lus10021576 [exp] 72 / 4e-16 AT5G57030 805 / 0.0 LUTEIN DEFICIENT 2, Lycopene beta/epsilon cyclase protein (.1) Lus10017156 [exp] 71 / 2e-15 AT5G57030 801 / 0.0 LUTEIN DEFICIENT 2, Lycopene beta/epsilon cyclase protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G159800 [exp] 157 / 3e-47 AT3G10230 538 / 0.0 lycopene cyclase (.1.2) Potri.004G197100 [exp] 155 / 1e-46 AT3G10230 533 / 0.0 lycopene cyclase (.1.2) Potri.016G040200 [exp] 135 / 9e-39 AT3G10230 770 / 0.0 lycopene cyclase (.1.2) Potri.006G043092 [exp] 133 / 5e-38 AT3G10230 794 / 0.0 lycopene cyclase (.1.2) Potri.001G229166 [exp] 92 / 3e-25 AT3G10230 137 / 7e-40 lycopene cyclase (.1.2) Potri.006G147300 [exp] 70 / 3e-15 AT5G57030 723 / 0.0 LUTEIN DEFICIENT 2, Lycopene beta/epsilon cyclase protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF05834 [flax] [poplar] Lycopene_cycl Lycopene cyclase protein
Representative CDS sequence Show only first row Show all	>Lus10005189 pacid=23145836 polypeptide=Lus10005189 locus=Lus10005189.g ID=Lus10005189.BGIv1.0 annot-version=v1.0 ATGGTGTTGATGGACTGGAGGGATTCTCACATGGGGAACGAGCCGTATCTGAGGAAGGGGAATTGTAAGGTTCCGACGTTCTTGTACGCGATGCCGTTTG ATTCCGATCTGGTGTTTTTGGAGGAGACGAGTCTGGTGAGCCGGGGGCCGGTTTTGGGGTACAGGGAGGTGAAGAAGAGGATGGATGCGAGGTTGAGGCA TTTGGGAATTAGAGTTAAGAGGGTGATTGAAGAGGAGAAGTGTTTGATTCCGATGGGTGGGAGGTTGCCGGCGATGCCGCAGAGGGTGGTTGGGTTTGTT GGGGCGCTAGCGGAAATGTAG
AA sequence Show only first row Show all	>Lus10005189 pacid=23145836 polypeptide=Lus10005189 locus=Lus10005189.g ID=Lus10005189.BGIv1.0 annot-version=v1.0 MVLMDWRDSHMGNEPYLRKGNCKVPTFLYAMPFDSDLVFLEETSLVSRGPVLGYREVKKRMDARLRHLGIRVKRVIEEEKCLIPMGGRLPAMPQRVVGFV GALAEM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G10230		AtLCY, LYC	lycopene cyclase (.1.2)		Lus10005189 [exp]	0	1
AT2G30490		REF3, CYP73A5, ...	REDUCED EPRDERMAL FLUORESCENCE...		Lus10035011 [exp]	8.0	0.9316
AT2G30490		REF3, CYP73A5, ...	REDUCED EPRDERMAL FLUORESCENCE...		Lus10034449 [exp]	8.1	0.9324
AT1G15950		IRX4, ATCCR1, C...	IRREGULAR XYLEM 4, cinnamoyl c...		Lus10041651 [exp]	14.0	0.9084
AT1G22410			Class-II DAHP synthetase famil...		Lus10035923 [exp]	14.1	0.9128
AT3G10230		AtLCY, LYC	lycopene cyclase (.1.2)		Lus10013298 [exp]	14.2	0.8748
AT2G37040		PAL1, ATPAL1	PHE ammonia lyase 1 (.1)		Lus10023531 [exp]	16.4	0.9071
AT3G53720		ATCHX20	cation/H+ exchanger 20, cation...		Lus10025325 [exp]	16.7	0.8843
AT5G48930		HCT	hydroxycinnamoyl-CoA shikimate...		Lus10026097 [exp]	20.5	0.9058
AT4G01070		UGT72B1, GT72B1	UDP-GLUCOSE-DEPENDENT GLUCOSYL...		Lus10005950 [exp]	22.6	0.9017
AT3G17390		MAT4, SAMS3, MT...	S-ADENOSYLMETHIONINE SYNTHETAS...		Lus10038044 [exp]	24.7	0.8957

Compare expression of checked genes

Lus10005189 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.