Lus10005190 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G10230 159 / 2e-48 AtLCY, LYC lycopene cyclase (.1.2)
AT5G57030 72 / 1e-15 LUT2 LUTEIN DEFICIENT 2, Lycopene beta/epsilon cyclase protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013298 263 / 5e-87 AT3G10230 508 / 3e-177 lycopene cyclase (.1.2)
Lus10027278 157 / 3e-46 AT3G10230 832 / 0.0 lycopene cyclase (.1.2)
Lus10038986 155 / 6e-46 AT3G10230 831 / 0.0 lycopene cyclase (.1.2)
Lus10021576 77 / 3e-17 AT5G57030 805 / 0.0 LUTEIN DEFICIENT 2, Lycopene beta/epsilon cyclase protein (.1)
Lus10017156 73 / 1e-15 AT5G57030 801 / 0.0 LUTEIN DEFICIENT 2, Lycopene beta/epsilon cyclase protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G159800 192 / 4e-60 AT3G10230 538 / 0.0 lycopene cyclase (.1.2)
Potri.004G197100 179 / 6e-55 AT3G10230 533 / 0.0 lycopene cyclase (.1.2)
Potri.006G043092 160 / 2e-47 AT3G10230 794 / 0.0 lycopene cyclase (.1.2)
Potri.016G040200 159 / 2e-47 AT3G10230 770 / 0.0 lycopene cyclase (.1.2)
Potri.006G147300 69 / 2e-14 AT5G57030 723 / 0.0 LUTEIN DEFICIENT 2, Lycopene beta/epsilon cyclase protein (.1)
Potri.001G229166 62 / 9e-13 AT3G10230 137 / 7e-40 lycopene cyclase (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF05834 Lycopene_cycl Lycopene cyclase protein
Representative CDS sequence
>Lus10005190 pacid=23145827 polypeptide=Lus10005190 locus=Lus10005190.g ID=Lus10005190.BGIv1.0 annot-version=v1.0
ATGAGGGTACGATCGGTTAGATATTTGGTTGCTCGAACCTTAGCTCTAGCCCCAATCCTAGCTGACGTAATAGCAGAGTGCCTCGGCTCAACTAGGATGA
TTCGAGGCACTCTGTTATATGACCGCATATGGAAAGGGCTATGGACATTCGATAGGAAATCAGAAAGAAAATTCTACAGATTTGGAATGGAGACATTGTT
GAAATTCGACCTTAATGATACGAGAAGGTTTTTCGATGCCTTCTTCGATCTGGACCCTCACTACTGGCAAGGATTTCTTTCTTCGAAGCTCTCGCTTCCA
GAGCTCATGTGGTTAAGCCTTTCTCTCTTCAGACATGCCTCAAATCCTTCGAGGGTTGATATTGTGACCAAGTGCCCTTTGCCTTTGGCTAAAATGGTGG
GTAATTTGGCTCTCGAGTCCATCTGA
AA sequence
>Lus10005190 pacid=23145827 polypeptide=Lus10005190 locus=Lus10005190.g ID=Lus10005190.BGIv1.0 annot-version=v1.0
MRVRSVRYLVARTLALAPILADVIAECLGSTRMIRGTLLYDRIWKGLWTFDRKSERKFYRFGMETLLKFDLNDTRRFFDAFFDLDPHYWQGFLSSKLSLP
ELMWLSLSLFRHASNPSRVDIVTKCPLPLAKMVGNLALESI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G10230 AtLCY, LYC lycopene cyclase (.1.2) Lus10005190 0 1
AT1G78690 Phospholipid/glycerol acyltran... Lus10004768 3.0 0.8258
AT1G08030 AQC1, TPST active quiescent center1, tyro... Lus10016093 4.9 0.8178
Lus10013650 5.7 0.8223
AT1G28520 VOZ ATVOZ1, VOZ1 vascular plant one zinc finger... Lus10017700 8.1 0.7883
AT5G44960 F-box/RNI-like/FBD-like domain... Lus10015246 8.5 0.8122
Lus10013649 9.9 0.7738
Lus10024480 11.2 0.7691
AT5G52260 MYB ATMYB19 myb domain protein 19 (.1) Lus10027456 13.9 0.7755
AT5G18580 FASS2, TON2, GD... GORDO, FASS 1, EMBRYO DEFECTIV... Lus10002884 14.4 0.7194
Lus10039764 15.2 0.7714

Lus10005190 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.