Lus10005202 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06620 104 / 9e-27 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59530 103 / 2e-26 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G04380 102 / 5e-26 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G43440 101 / 1e-25 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G04350 101 / 1e-25 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59540 100 / 2e-25 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT5G43450 100 / 4e-25 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G03400 99 / 9e-25 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G61400 96 / 1e-23 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G03410 96 / 1e-23 2A6 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013315 161 / 2e-51 AT5G59540 64 / 2e-13 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10009238 136 / 9e-39 AT1G06640 250 / 2e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
Lus10041230 105 / 3e-28 AT5G59530 270 / 1e-90 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10027585 108 / 4e-28 AT1G06620 429 / 3e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10000610 100 / 3e-27 AT5G59530 170 / 1e-52 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022193 105 / 5e-27 AT1G06620 455 / 1e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022195 105 / 8e-27 AT1G06620 432 / 1e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022189 104 / 9e-27 AT1G06620 418 / 3e-146 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021943 104 / 1e-26 AT1G06620 443 / 5e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G045000 120 / 2e-32 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073100 120 / 2e-32 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.010G073300 117 / 2e-31 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.005G222300 108 / 5e-28 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073232 107 / 8e-28 AT1G06620 402 / 7e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073166 105 / 4e-27 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.008G165400 105 / 5e-27 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G135800 105 / 8e-27 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G156200 103 / 1e-26 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.002G040700 103 / 2e-26 AT1G06620 330 / 2e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10005202 pacid=23145845 polypeptide=Lus10005202 locus=Lus10005202.g ID=Lus10005202.BGIv1.0 annot-version=v1.0
ATGCCAACGATAGTCAACTATGCACACGAGCACCATATTGAAATTCTCAGACCACATCCGAGAACTCGGTACGACCTTATCCGAACTGTTCTCAGAAGCA
CTAGGACTATCACCAAATCACCTGAAGCAAATCAACTAGCCTGTCCTGAACTGGAAGTCGCCACAGGTCAACGCCCACATTTCGACCCGTTTACTTTCAC
CGTTCTGCTTCAAGACCGAACTGGAGGGCTGCAGGTTTTCCACGGCGGATGGGTCAACGTTCCTCCTCTTCCCGACGTTTTTACCGTCAACGTCGAAAAT
TTTATGCAGCTGATAAGCAATGGCAGAATGAAGAGCGGAGAGCATAAGGTGGTAATGAATCGAACCGGGTCGAGAGTTTCGGCCGGGTTCTTTTTTGAGC
CGGTTATCAATTTTTCGAATGCTTCGGAGAAAATGTACGTTCCGATCAAGGAGTTGATATCTGAAGAGCATCCTAAGGTGTATCGTGAAATTAGTTTGGT
TGAGTTGCTGGACACTGTGTTTCCAGACTGCGAAGCATATAATGAGAGGAATTCTGGAATGGCTGGTTTCAAGCTACAATAG
AA sequence
>Lus10005202 pacid=23145845 polypeptide=Lus10005202 locus=Lus10005202.g ID=Lus10005202.BGIv1.0 annot-version=v1.0
MPTIVNYAHEHHIEILRPHPRTRYDLIRTVLRSTRTITKSPEANQLACPELEVATGQRPHFDPFTFTVLLQDRTGGLQVFHGGWVNVPPLPDVFTVNVEN
FMQLISNGRMKSGEHKVVMNRTGSRVSAGFFFEPVINFSNASEKMYVPIKELISEEHPKVYREISLVELLDTVFPDCEAYNERNSGMAGFKLQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10005202 0 1

Lus10005202 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.