Lus10005203 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000801 205 / 1e-66 ND /
Lus10015702 189 / 2e-62 ND 38 / 0.004
Lus10032804 188 / 5e-62 ND /
Lus10005265 167 / 6e-55 ND /
Lus10010778 166 / 2e-54 ND /
Lus10010402 164 / 1e-52 ND /
Lus10020608 160 / 2e-52 ND /
Lus10003364 160 / 5e-52 ND /
Lus10000302 160 / 1e-51 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10005203 pacid=23145831 polypeptide=Lus10005203 locus=Lus10005203.g ID=Lus10005203.BGIv1.0 annot-version=v1.0
ATGTGGTTGGAGCAGGACTTCATCAGATTTCACCGGCTACACCTTATGTTCGAGAGGGCGTCGGCTGGGGGGGGTGGTGGTGCTCGGCTACACCTTATGT
TCGAGAGGGCGTCGGCTGGTGGGGATGTTGGTCCAGGGTACATGGACTGGTTCCTCGAGCACAGTCACCCACGCATCGTGGCGCCGGCTAACCCCGGTGT
GGGAGTCCCGGCTGAGCTGATTACACAGCGAGTGTTCGATGGTATGGCCTCCTACTTCGATGGCACGCTTGGGCGGCAGCACGCCGACTCTCTTCAGGAG
TACTACGACCACATGGAGGGGCTTCGGGGGCCGGTTGGGGGTCTCTATACGGGGGAACGGAGGCCGAGAGATCTCTATACGGGGTATCGGAGCCAGAGAG
AGAGTTGA
AA sequence
>Lus10005203 pacid=23145831 polypeptide=Lus10005203 locus=Lus10005203.g ID=Lus10005203.BGIv1.0 annot-version=v1.0
MWLEQDFIRFHRLHLMFERASAGGGGGARLHLMFERASAGGDVGPGYMDWFLEHSHPRIVAPANPGVGVPAELITQRVFDGMASYFDGTLGRQHADSLQE
YYDHMEGLRGPVGGLYTGERRPRDLYTGYRSQRES

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10005203 0 1
AT3G26660 AS2 LBD24 LOB domain-containing protein ... Lus10023434 1.4 0.7098
AT3G54200 Late embryogenesis abundant (L... Lus10039665 5.1 0.7635
AT1G02335 GL22 germin-like protein subfamily ... Lus10004855 8.1 0.6942
AT2G27035 AtENODL20 early nodulin-like protein 20 ... Lus10025536 9.8 0.6185
AT5G17760 P-loop containing nucleoside t... Lus10041777 10.6 0.6896
AT3G18180 Glycosyltransferase family 61 ... Lus10032457 12.2 0.6376
AT1G27220 paired amphipathic helix repea... Lus10000805 18.7 0.6166
Lus10033096 20.0 0.6166
AT1G32450 NRT1.5 nitrate transporter 1.5 (.1) Lus10030286 21.2 0.6166
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10021338 22.4 0.6166

Lus10005203 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.