Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G44220 48 / 9e-08 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G11660 43 / 5e-06 NHL1 NDR1/HIN1-like 1 (.1) AT2G35970 43 / 6e-06 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G06330 43 / 7e-06 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT4G09590 43 / 1e-05 NHL22 NDR1/HIN1-like 22 (.1) AT2G35960 37 / 0.0006 NHL12 NDR1/HIN1-like 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013327 [exp] 90 / 2e-23 AT3G11660 147 / 2e-44 NDR1/HIN1-like 1 (.1) Lus10043410 [exp] 66 / 5e-14 AT3G44220 207 / 6e-68 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10034175 [exp] 64 / 2e-13 AT3G44220 210 / 7e-69 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G019600 [exp] 50 / 2e-08 AT3G44220 242 / 8e-82 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.006G204200 [exp] 49 / 3e-08 AT3G11660 267 / 1e-91 NDR1/HIN1-like 1 (.1) Potri.016G071500 [exp] 47 / 4e-07 AT3G11660 272 / 1e-93 NDR1/HIN1-like 1 (.1) Potri.012G006000 [exp] 42 / 2e-05 AT5G53730 225 / 4e-75 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.015G002400 [exp] 40 / 8e-05 AT5G53730 227 / 7e-76 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005214 pacid=23145837 polypeptide=Lus10005214 locus=Lus10005214.g ID=Lus10005214.BGIv1.0 annot-version=v1.0 ATGTGGGGCCACCTCTCGTACCGTGGTCAGCAGATCACCCTGCCCGTGAAGCTCCCCCGTACTCACTTGGGGGAGAAAGAAGCGGTCGACTTGTCGTTCC CTGTATTGTCTGGAGAGAGCGTGATTGCGGCTGTGGTGGGCCAGGATCTGAGCGCTGGAGTGTTCCCGTTGGAGTTGAAGGTGCACGGAAAGATTAGGAA GTCCTTCTGGAAGTATGGTCTGGATGTTAACTGTCCGGTTAGTGACCTCTCGACGTCCGACGGCGGAGGAGGAAGGGTTTGGTATGAGTCGGCTAATCAT CATTGTAACGTTGTCGTGGTGGGTTAA
AA sequence Show only first row Show all	>Lus10005214 pacid=23145837 polypeptide=Lus10005214 locus=Lus10005214.g ID=Lus10005214.BGIv1.0 annot-version=v1.0 MWGHLSYRGQQITLPVKLPRTHLGEKEAVDLSFPVLSGESVIAAVVGQDLSAGVFPLELKVHGKIRKSFWKYGLDVNCPVSDLSTSDGGGGRVWYESANH HCNVVVVG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G44220			Late embryogenesis abundant (L...		Lus10005214 [exp]	0	1
AT2G31180	MYB	ATMYB14, Myb14a...	ARABIDOPSIS THALIANA MYB DOMAI...		Lus10022021 [exp]	2.4	0.9695
AT4G29340		PRF4	profilin 4 (.1)		Lus10012935 [exp]	3.5	0.9695
AT3G02100			UDP-Glycosyltransferase superf...		Lus10003456 [exp]	4.2	0.9695
AT2G04810			Protein of unknown function (D...		Lus10020538 [exp]	4.9	0.9669
AT3G09290	C2H2ZnF	TAC1	telomerase activator1 (.1)		Lus10021213 [exp]	5.5	0.9651
AT1G78580		ATTPS1	TREHALOSE-6-PHOSPHATE SYNTHASE...		Lus10015243 [exp]	6.3	0.8285
AT4G16270			Peroxidase superfamily protein...		Lus10017069 [exp]	6.5	0.9428
AT5G09360		LAC14	laccase 14 (.1)		Lus10026812 [exp]	7.0	0.9246
AT5G59310		LTP4	lipid transfer protein 4 (.1)		Lus10028003 [exp]	7.3	0.9023
AT3G14470			NB-ARC domain-containing disea...		Lus10032781 [exp]	7.5	0.9090

Compare expression of checked genes

Lus10005214 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.