Lus10005225 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037806 94 / 2e-24 ND /
Lus10032473 79 / 5e-18 ND /
Lus10020920 39 / 0.0007 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10005225 pacid=23155718 polypeptide=Lus10005225 locus=Lus10005225.g ID=Lus10005225.BGIv1.0 annot-version=v1.0
ATGGGTTTCTCAGTTTTGAAAGACCTTGAAGTTATGACGAAGTGGATGTCGCGTTCGCCTAGTGAGGATTCACTGAATTTTTTAGGAGGTAAAGTCATCT
ACTTCCGCCTCGACTTTGAGGCCGACTCAAACGGTGATCCAAACTACGACTCCCCACCTGACTGTGACGACTGTGAACCATACTACTACAACTCCGAACC
TTACTACGATGGTGGTCCTGAAGTCATCGATTATGAGGGGAGCTCTGCTGGAGATTGTAAAGACGAAGATTTCGTGGTTGATGAAAGGGAATTGGCTGAC
GATGATGATGACACACCAGCATCAAGTCCGGTAGACGCAGACCTATCCTTCGATGAAGATGAACCAATGAGGCAAACTGGATGGGGATCAGAAGAAGATA
TCAGCACTGTCCCACTCGGGTACCCACGATTTGATTTATGTAGGGATCTGGATGATGCTGAAAGTGTTTTTGGTAGGGAGTACGGTTCTGTTCAAGATTT
CAAATAG
AA sequence
>Lus10005225 pacid=23155718 polypeptide=Lus10005225 locus=Lus10005225.g ID=Lus10005225.BGIv1.0 annot-version=v1.0
MGFSVLKDLEVMTKWMSRSPSEDSLNFLGGKVIYFRLDFEADSNGDPNYDSPPDCDDCEPYYYNSEPYYDGGPEVIDYEGSSAGDCKDEDFVVDERELAD
DDDDTPASSPVDADLSFDEDEPMRQTGWGSEEDISTVPLGYPRFDLCRDLDDAESVFGREYGSVQDFK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10005225 0 1
Lus10001186 5.0 0.7897
Lus10027680 7.2 0.7745
AT1G20330 FRL1, CVP1, SMT... FRILL1, COTYLEDON VASCULAR PAT... Lus10004158 9.3 0.7642
Lus10000984 10.8 0.7642
AT3G05550 Hypoxia-responsive family prot... Lus10031490 12.0 0.7642
Lus10017835 13.2 0.7642
Lus10040014 14.2 0.7642
AT3G23350 ENTH/VHS family protein (.1) Lus10021173 15.2 0.7642
AT1G06770 DRIP1 DREB2A-interacting protein 1 (... Lus10042532 16.2 0.7642
AT5G44400 FAD-binding Berberine family p... Lus10027162 17.0 0.7642

Lus10005225 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.