Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030680 [exp] 51 / 2e-09 AT5G15230 131 / 5e-41 GAST1 protein homolog 4 (.1.2) Lus10042203 [exp] 42 / 6e-06 AT1G74670 138 / 6e-44 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10008612 [exp] 39 / 6e-05 AT1G74670 138 / 8e-44 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G083000 [exp] 38 / 0.0002 AT5G15230 116 / 3e-35 GAST1 protein homolog 4 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005241 pacid=23155693 polypeptide=Lus10005241 locus=Lus10005241.g ID=Lus10005241.BGIv1.0 annot-version=v1.0 ATGGCCAAGTTGCTTGCCGTCTTCCTCTTGGCCCTCATTGCTATCTCCACTCTCCAATCTGTGGTCATGGCTTCCCGTGGACGTGGCGGCCACCACTACG ACAACAAGAATGCCCATCTCGATGCTCGAAGAGGTGCAGCAAGACGCAGCACCGCAAGCCGTGCATGTTCTTCTGCCAAATGTGCTGCAGCAAATGCTTG TGCGTGCCTGGAGGTTACTACGGAAACAAGGCTGTTTGCCCTTGCTATAACAACTGGAAGACCCAGGAAGGAAAACCCAAATGTCCTTAAACTCAAAGTT TCTTAA
AA sequence Show only first row Show all	>Lus10005241 pacid=23155693 polypeptide=Lus10005241 locus=Lus10005241.g ID=Lus10005241.BGIv1.0 annot-version=v1.0 MAKLLAVFLLALIAISTLQSVVMASRGRGGHHYDNKNAHLDARRGAARRSTASRACSSAKCAAANACACLEVTTETRLFALAITTGRPRKENPNVLKLKV S

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10005241 [exp]	0	1
AT1G60790		TBL2	TRICHOME BIREFRINGENCE-LIKE 2,...		Lus10030590 [exp]	5.8	0.9036
AT2G21400		SRS3	SHI-related sequence3 (.1)		Lus10017492 [exp]	16.7	0.8252
AT5G04220		SYT3, NTMCTYPE1...	synaptotagmin 3, Calcium-depen...		Lus10013802 [exp]	17.7	0.8311
AT5G63180			Pectin lyase-like superfamily ...		Lus10014887 [exp]	19.8	0.8419
AT4G39150			DNAJ heat shock N-terminal dom...		Lus10017980 [exp]	20.2	0.8872
AT3G02230		ATRGP1, RGP1	ARABIDOPSIS THALIANA REVERSIBL...		Lus10016749 [exp]	23.5	0.8459
AT1G25520			Uncharacterized protein family...		Lus10021697 [exp]	23.6	0.8482
					Lus10010608 [exp]	24.1	0.8751
AT5G08100		ASPGA1	asparaginase A1, N-terminal nu...		Lus10017879 [exp]	24.9	0.8788
AT4G23430		AtTic32-IVa	translocon at the inner envelo...		Lus10024685 [exp]	26.2	0.8786

Compare expression of checked genes

Lus10005241 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.