Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030676 [exp] 88 / 1e-24 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G122800 [exp] 42 / 1e-06 ND / Potri.017G084700 [exp] 42 / 2e-06 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005247 pacid=23155707 polypeptide=Lus10005247 locus=Lus10005247.g ID=Lus10005247.BGIv1.0 annot-version=v1.0 ATGGGTCGGTCTTGTTTCGTCATTAGCAGCTTTGCTCCTCTGTTACTAGTTCTACTTCTCCTGCTTCCATCCCACGGTTTCATTGCTGGTAGAAAGATGG CTAATGGGTTCGGACTAGTGGATGCTTTCGCGGAGGAATCAAGGGAGCTATCAGAGGAGTCGGTTGATTATCAGCTAGATCCGGAGCCCAACACGAATCC GAGGAATGGGTTCGTGTATCCTCCTCCGACCGAGGCCCCGCCTCCAGTTCCCGATTGGTGA
AA sequence Show only first row Show all	>Lus10005247 pacid=23155707 polypeptide=Lus10005247 locus=Lus10005247.g ID=Lus10005247.BGIv1.0 annot-version=v1.0 MGRSCFVISSFAPLLLVLLLLLPSHGFIAGRKMANGFGLVDAFAEESRELSEESVDYQLDPEPNTNPRNGFVYPPPTEAPPPVPDW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10005247 [exp]	0	1
AT2G30130	AS2	PCK1, LBD12, AS...	PEACOCK 1, Lateral organ bound...		Lus10031855 [exp]	2.2	0.9407
AT5G10130			Pollen Ole e 1 allergen and ex...		Lus10041707 [exp]	11.3	0.9376
AT5G54370			Late embryogenesis abundant (L...		Lus10031297 [exp]	14.7	0.9371
AT4G31470			CAP (Cysteine-rich secretory p...		Lus10011318 [exp]	16.7	0.9276
AT4G30320			CAP (Cysteine-rich secretory p...		Lus10001319 [exp]	18.1	0.9225
AT1G23210		ATGH9B6	glycosyl hydrolase 9B6 (.1)		Lus10027201 [exp]	20.5	0.9149
AT5G60520			Late embryogenesis abundant (L...		Lus10036107 [exp]	21.9	0.9267
AT3G14470			NB-ARC domain-containing disea...		Lus10002609 [exp]	22.4	0.9271
AT5G10720		CKI2, AHK5	CYTOKININ INDEPENDENT 2, histi...		Lus10000137 [exp]	24.1	0.8865
AT4G37160		SKS15	SKU5 similar 15 (.1)		Lus10019642 [exp]	27.5	0.9242

Compare expression of checked genes

Lus10005247 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.