Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G39860 49 / 2e-09 bHLH BNQ1, BHLH136, PRE1 PACLOBUTRAZOL RESISTANCE1, BANQUO 1, BASIC HELIX-LOOP-HELIX PROTEIN 136, basic helix-loop-helix (bHLH) DNA-binding family protein (.1) AT3G28857 49 / 3e-09 bHLH PRE5 Paclobutrazol Resistance 5, basic helix-loop-helix (bHLH) DNA-binding family protein (.1) AT5G15160 40 / 4e-06 bHLH BNQ2, BHLH134, PRE2 BASIC HELIX-LOOP-HELIX PROTEIN 134, BANQUO 2 (.1) AT1G74500 40 / 8e-06 bHLH TMO7, PRE3, ATBS1, bHLH135 TARGET OF MONOPTEROS 7, activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 1 (.1) AT1G26945 35 / 0.0006 bHLH KDR, PRE6 KIDARI, basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030675 [exp] 67 / 2e-16 AT3G28857 61 / 8e-14 Paclobutrazol Resistance 5, basic helix-loop-helix (bHLH) DNA-binding family protein (.1) Lus10023610 [exp] 46 / 4e-08 AT3G28857 109 / 9e-33 Paclobutrazol Resistance 5, basic helix-loop-helix (bHLH) DNA-binding family protein (.1) Lus10024241 [exp] 46 / 5e-08 AT3G47710 123 / 2e-38 BASIC HELIX-LOOP-HELIX PROTEIN 161, BANQUO 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G128400 [exp] 55 / 9e-12 AT5G39860 124 / 8e-39 PACLOBUTRAZOL RESISTANCE1, BANQUO 1, BASIC HELIX-LOOP-HELIX PROTEIN 136, basic helix-loop-helix (bHLH) DNA-binding family protein (.1) Potri.017G081300 [exp] 52 / 2e-10 AT5G39860 126 / 1e-39 PACLOBUTRAZOL RESISTANCE1, BANQUO 1, BASIC HELIX-LOOP-HELIX PROTEIN 136, basic helix-loop-helix (bHLH) DNA-binding family protein (.1) Potri.012G069500 [exp] 40 / 8e-06 AT1G74500 81 / 2e-21 TARGET OF MONOPTEROS 7, activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 1 (.1) Potri.015G063300 [exp] 39 / 3e-05 AT1G74500 75 / 3e-19 TARGET OF MONOPTEROS 7, activation-tagged BRI1(brassinosteroid-insensitive 1)-suppressor 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005248 pacid=23155686 polypeptide=Lus10005248 locus=Lus10005248.g ID=Lus10005248.BGIv1.0 annot-version=v1.0 ATGTCAGGCAGGAGAGGCTCATCGAGGCACTCATCGGGGGTTCCGAGGATTACCGATGACCAGATCATTCAACTCGTCTCCAAGCTTCGCCAGCTCCTCC CCGAGATCCGCCAAACCCGCCGCTCCGACAAGGTACTACCATACCATACCATACCATACGACTTGTCGCTTCTCTACCTTCTTCTCTTTAACTTCTTTGG CCTAGCTACCTAG
AA sequence Show only first row Show all	>Lus10005248 pacid=23155686 polypeptide=Lus10005248 locus=Lus10005248.g ID=Lus10005248.BGIv1.0 annot-version=v1.0 MSGRRGSSRHSSGVPRITDDQIIQLVSKLRQLLPEIRQTRRSDKVLPYHTIPYDLSLLYLLLFNFFGLAT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G28857	bHLH	PRE5	Paclobutrazol Resistance 5, ba...		Lus10005248 [exp]	0	1
AT5G50335			unknown protein		Lus10001469 [exp]	3.2	0.8967
AT5G12250		TUB6	beta-6 tubulin (.1)		Lus10008528 [exp]	5.8	0.8941
AT1G23965			unknown protein		Lus10030844 [exp]	6.7	0.8896
AT1G33811			GDSL-like Lipase/Acylhydrolase...		Lus10000893 [exp]	7.2	0.8308
AT2G37640		ATHEXPALPHA1.9,...	ARABIDOPSIS THALIANA EXPANSIN ...		Lus10024388 [exp]	9.2	0.8895
AT5G23730		EFO2, RUP2	REPRESSOR OF UV-B PHOTOMORPHOG...		Lus10027454 [exp]	9.4	0.8331
AT3G04910		ATWNK1, ZIK4, W...	with no lysine (K) kinase 1 (....		Lus10001789 [exp]	10.0	0.8364
AT1G53700		PK3AT, WAG1	PROTEIN KINASE 3 ARABIDOPSIS T...		Lus10005583 [exp]	10.2	0.8272
AT3G04730	AUX_IAA	IAA16	indoleacetic acid-induced prot...		Lus10014731 [exp]	11.6	0.8594
AT3G24670			Pectin lyase-like superfamily ...		Lus10022817 [exp]	13.0	0.8730

Compare expression of checked genes

Lus10005248 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.