Lus10005268 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G51990 101 / 2e-26 O-methyltransferase family protein (.1.2)
AT1G77520 99 / 2e-25 O-methyltransferase family protein (.1)
AT1G77530 96 / 2e-24 O-methyltransferase family protein (.1)
AT4G35150 96 / 3e-24 O-methyltransferase family protein (.1)
AT4G35160 95 / 7e-24 O-methyltransferase family protein (.1)
AT1G62900 91 / 2e-23 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT1G33030 92 / 9e-23 O-methyltransferase family protein (.1)
AT1G63140 91 / 2e-22 O-methyltransferase family protein (.1.2)
AT5G53810 91 / 3e-22 O-methyltransferase family protein (.1)
AT1G21130 91 / 3e-22 IGMT4 indole glucosinolate O-methyltransferase 4, O-methyltransferase family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013945 251 / 1e-84 AT4G35160 181 / 1e-53 O-methyltransferase family protein (.1)
Lus10033656 157 / 1e-47 AT4G35150 211 / 8e-65 O-methyltransferase family protein (.1)
Lus10017699 152 / 1e-45 AT4G35150 204 / 2e-62 O-methyltransferase family protein (.1)
Lus10015311 150 / 8e-45 AT4G35160 189 / 1e-56 O-methyltransferase family protein (.1)
Lus10018629 145 / 5e-43 AT4G35160 214 / 3e-66 O-methyltransferase family protein (.1)
Lus10017695 135 / 2e-40 AT4G35150 140 / 6e-40 O-methyltransferase family protein (.1)
Lus10018628 137 / 8e-40 AT4G35160 192 / 7e-58 O-methyltransferase family protein (.1)
Lus10017691 134 / 1e-38 AT4G35160 194 / 2e-58 O-methyltransferase family protein (.1)
Lus10008538 133 / 2e-38 AT4G35160 167 / 5e-48 O-methyltransferase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G059500 185 / 2e-58 AT4G35160 177 / 6e-52 O-methyltransferase family protein (.1)
Potri.004G050400 177 / 2e-55 AT4G35160 191 / 2e-57 O-methyltransferase family protein (.1)
Potri.004G050500 165 / 6e-51 AT4G35160 178 / 2e-52 O-methyltransferase family protein (.1)
Potri.011G059600 164 / 2e-50 AT4G35160 196 / 3e-59 O-methyltransferase family protein (.1)
Potri.013G122000 157 / 1e-47 AT4G35160 174 / 6e-51 O-methyltransferase family protein (.1)
Potri.019G093100 157 / 1e-47 AT4G35160 225 / 1e-70 O-methyltransferase family protein (.1)
Potri.013G121900 154 / 2e-46 AT4G35160 184 / 5e-55 O-methyltransferase family protein (.1)
Potri.019G093000 154 / 2e-46 AT4G35160 230 / 1e-72 O-methyltransferase family protein (.1)
Potri.013G120800 153 / 3e-46 AT4G35160 205 / 7e-63 O-methyltransferase family protein (.1)
Potri.013G121800 149 / 2e-45 AT4G35160 158 / 7e-46 O-methyltransferase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF00891 Methyltransf_2 O-methyltransferase domain
Representative CDS sequence
>Lus10005268 pacid=23175311 polypeptide=Lus10005268 locus=Lus10005268.g ID=Lus10005268.BGIv1.0 annot-version=v1.0
ATGGATTGTGTTGTGTTGGATCTACCACAAGTTGTTGATGGCTTGTTAGATGAGAAGAGGCTGAAATTTGTTGGTGGTGACATGTTTGAGTTTGTCCCTT
CTGCAGAAGCCATACTGATCAAGTTCGTTCTGCACAACTGGACCGACGAGGACTGTATAAAGATACTAAAGAGATGCAAAGAGGCAATCCAAGAGGAGAA
GAAGGGGAAGTTGATTCTGATAGAAATGGTGATCGAGGAATCGGAAAACGAAGGCGAATTGAGCAAGACTTGGCTGTTGATGGACATGGAAATGATGATG
TTGTGTCAAGGGAAAGAAAGAACTGAAGCAGAATGGAAGAATCTCTTCTTGGAATCTGGATTTATCAGCTTCAAGATCACTCAAACAGCTCGATTGAAGT
CCATCATTGAAGTTCATCCTTGA
AA sequence
>Lus10005268 pacid=23175311 polypeptide=Lus10005268 locus=Lus10005268.g ID=Lus10005268.BGIv1.0 annot-version=v1.0
MDCVVLDLPQVVDGLLDEKRLKFVGGDMFEFVPSAEAILIKFVLHNWTDEDCIKILKRCKEAIQEEKKGKLILIEMVIEESENEGELSKTWLLMDMEMMM
LCQGKERTEAEWKNLFLESGFISFKITQTARLKSIIEVHP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G51990 O-methyltransferase family pro... Lus10005268 0 1
AT1G61330 FBD, F-box and Leucine Rich Re... Lus10018433 3.5 0.8802
AT3G19850 Phototropic-responsive NPH3 fa... Lus10029070 5.7 0.7348
Lus10010526 6.5 0.8269
AT5G53820 Late embryogenesis abundant pr... Lus10003056 6.6 0.8512
AT2G15220 Plant basic secretory protein ... Lus10013860 7.9 0.6718
AT4G23160 CRK8 cysteine-rich RLK (RECEPTOR-li... Lus10015093 8.9 0.8026
AT3G12160 AtRABA4d ARABIDOPSIS THALIANA RAB GTPAS... Lus10012032 9.2 0.8211
AT4G21390 B120 S-locus lectin protein kinase ... Lus10032836 12.0 0.7634
Lus10022511 13.0 0.7634
AT2G36690 2-oxoglutarate (2OG) and Fe(II... Lus10024231 13.9 0.7634

Lus10005268 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.