Lus10005270 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G65360 271 / 1e-95 Histone superfamily protein (.1)
AT5G10400 271 / 1e-95 Histone superfamily protein (.1)
AT5G10390 271 / 1e-95 Histone superfamily protein (.1)
AT3G27360 271 / 1e-95 Histone superfamily protein (.1)
AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
AT4G40040 265 / 3e-93 Histone superfamily protein (.1.2)
AT4G40030 265 / 3e-93 Histone superfamily protein (.1.2.3)
AT5G10980 265 / 3e-93 Histone superfamily protein (.1)
AT5G65350 260 / 3e-91 HTR11 histone 3 11 (.1)
AT1G75600 256 / 1e-89 Histone superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031822 272 / 5e-96 AT5G10400 271 / 1e-95 Histone superfamily protein (.1)
Lus10005271 272 / 5e-96 AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
Lus10031250 272 / 5e-96 AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
Lus10025439 272 / 5e-96 AT5G65360 271 / 1e-95 Histone superfamily protein (.1)
Lus10012744 272 / 6e-96 AT5G65360 271 / 2e-95 Histone superfamily protein (.1)
Lus10031821 274 / 8e-96 AT3G27360 273 / 3e-95 Histone superfamily protein (.1)
Lus10013948 273 / 2e-95 AT3G27360 272 / 7e-95 Histone superfamily protein (.1)
Lus10031252 270 / 5e-95 AT3G27360 268 / 2e-94 Histone superfamily protein (.1)
Lus10012757 220 / 1e-75 AT4G40030 229 / 3e-79 Histone superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G233900 272 / 4e-96 AT5G65360 271 / 1e-95 Histone superfamily protein (.1)
Potri.014G096900 271 / 1e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.002G028800 271 / 1e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G210100 271 / 1e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G207852 271 / 1e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G207700 271 / 1e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.001G016700 271 / 1e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.001G016900 271 / 1e-95 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.007G096700 265 / 3e-93 AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
Potri.007G014300 265 / 3e-93 AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF00125 Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence
>Lus10005270 pacid=23175306 polypeptide=Lus10005270 locus=Lus10005270.g ID=Lus10005270.BGIv1.0 annot-version=v1.0
ATGGCTCGTACCAAGCAAACAGCTCGCAAGTCCACCGGAGGCAAGGCGCCAAGGAAGCAGCTGGCGACCAAAGCAGCAAGGAAGTCAGCTCCGGCCACCG
GTGGAGTGAAGAAGCCCCACAGATTCAGGCCAGGAACTGTCGCCCTTCGTGAGATCCGCAAGTACCAGAAGAGCACCGAGCTTCTGATCCGCAAGCTCCC
CTTCCAGCGGCTAGTCCGTGAGATCGCCCAGGATTTCAAGACCGATCTCAGGTTCCAGAGCTCCGCCGTCTCTGCTCTCCAGGAAGCCGCCGAGGCTTAC
CTCGTCGGACTGTTCGAGGATACCAACCTCTGCGCCATTCACGCCAAGAGGGTTACTATCATGCCCAAGGACATCCAGCTCGCCAGAAGAATCAGAGGCG
AGCGTGCTTAG
AA sequence
>Lus10005270 pacid=23175306 polypeptide=Lus10005270 locus=Lus10005270.g ID=Lus10005270.BGIv1.0 annot-version=v1.0
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVSALQEAAEAY
LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G09200 Histone superfamily protein (.... Lus10005270 0 1
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10037371 1.7 0.9799
AT3G27360 Histone superfamily protein (.... Lus10013948 4.7 0.9720
AT5G02570 Histone superfamily protein (.... Lus10040850 5.3 0.9568
AT3G46940 DUT1 DUTP-PYROPHOSPHATASE-LIKE 1 (.... Lus10010809 6.1 0.9546
AT4G27660 unknown protein Lus10032928 6.9 0.9697
AT5G02560 HTA12 histone H2A 12 (.1.2) Lus10005892 9.4 0.9677
AT1G18650 PDCB3 plasmodesmata callose-binding ... Lus10040522 11.1 0.9708
AT1G65870 Disease resistance-responsive ... Lus10016231 11.5 0.9710
AT2G35160 SGD9, SUVH5 SET DOMAIN-CONTAINING PROTEIN ... Lus10043211 15.2 0.9699
AT3G19184 B3 AP2/B3-like transcriptional fa... Lus10032098 17.7 0.9544

Lus10005270 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.