Lus10005273 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G28510 142 / 1e-43 Optic atrophy 3 protein (OPA3) (.1)
AT3G58150 87 / 6e-22 Optic atrophy 3 protein (OPA3) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013949 215 / 2e-72 AT1G28510 238 / 3e-81 Optic atrophy 3 protein (OPA3) (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G059800 163 / 7e-52 AT1G28510 186 / 9e-61 Optic atrophy 3 protein (OPA3) (.1)
Potri.013G123000 133 / 4e-40 AT1G28510 174 / 3e-56 Optic atrophy 3 protein (OPA3) (.1)
Potri.019G092900 58 / 1e-11 AT1G28510 47 / 9e-08 Optic atrophy 3 protein (OPA3) (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0225 FtsL PF04977 DivIC Septum formation initiator
CL0225 PF07047 OPA3 Optic atrophy 3 protein (OPA3)
Representative CDS sequence
>Lus10005273 pacid=23175327 polypeptide=Lus10005273 locus=Lus10005273.g ID=Lus10005273.BGIv1.0 annot-version=v1.0
ATGGTGTTGCCATTGCTGAAGCTGGGAACTTTAGTGGTGAAGACGCTGAGCAAGCCGCTGGCTGCTAAGCTGAAGCAGCAGGCAGCTTACCATCCCAAGT
TCCGCCAAATCATCGTCGACATGGCGCAGTTGAATCACCGAATCTCGACGAGGATGCAACGGCGGATCTACAGCCACGCCACGGATGTGGCGATTCGGCC
GTTGAATGAGGAGAAAGCTGTCCAGGCTGCCGTCGATCTCATCGGCGAGTTGTTCGTTTTCACGGTTGCAGGAGCTGTTGTAGTATTTGAGGTGCAAAGA
AGTGCCAAATCAGAGGCTAGGAAAGAAGCAGCAAGGAAGCAAGAACTCGAGGCAATGAGGCAAAGAGATGAGGACTTGGCAAAAGAAGTGGAGAACCTAA
GACAAAAGCTGGAAGAGATCGAGCAACTTGCTAGAGGTCGAGGACTCAGCGGCCTTCTTCACTTGAAACCCTCGATCAAGGAGCCCGAAAAAACGATGAA
ACCAGCATAA
AA sequence
>Lus10005273 pacid=23175327 polypeptide=Lus10005273 locus=Lus10005273.g ID=Lus10005273.BGIv1.0 annot-version=v1.0
MVLPLLKLGTLVVKTLSKPLAAKLKQQAAYHPKFRQIIVDMAQLNHRISTRMQRRIYSHATDVAIRPLNEEKAVQAAVDLIGELFVFTVAGAVVVFEVQR
SAKSEARKEAARKQELEAMRQRDEDLAKEVENLRQKLEEIEQLARGRGLSGLLHLKPSIKEPEKTMKPA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G28510 Optic atrophy 3 protein (OPA3)... Lus10005273 0 1
AT4G01630 ATEXP17, ATHEXP... EXPANSIN 17, expansin A17 (.1) Lus10009253 10.2 0.8947
AT1G68150 WRKY ATWRKY9, WRKY9 WRKY DNA-binding protein 9 (.1... Lus10016682 11.4 0.9029
AT4G26910 Dihydrolipoamide succinyltrans... Lus10032633 16.6 0.8980
AT5G60700 glycosyltransferase family pro... Lus10037396 18.3 0.8960
AT1G43580 Sphingomyelin synthetase famil... Lus10042814 18.8 0.8878
AT2G43040 NPG1 no pollen germination 1, tetra... Lus10020725 24.4 0.8867
AT3G18830 ATPMT5, AtPLT5 ARABIDOPSIS THALIANA POLYOL/MO... Lus10035255 27.0 0.8940
AT2G22480 PFK5 phosphofructokinase 5 (.1) Lus10012738 29.6 0.8750
Lus10021703 30.8 0.8695
AT1G28290 AGP31 arabinogalactan protein 31 (.1... Lus10025526 34.6 0.8890

Lus10005273 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.