Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G31320 94 / 9e-24 AS2 LBD4 LOB domain-containing protein 4 (.1) AT2G30130 91 / 1e-22 AS2 PCK1, LBD12, ASL5 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) AT1G06280 87 / 6e-21 AS2 LBD2 LOB domain-containing protein 2 (.1) AT3G50510 85 / 5e-20 AS2 LBD28 LOB domain-containing protein 28 (.1) AT3G13850 86 / 6e-20 AS2 LBD22 LOB domain-containing protein 22 (.1) AT5G66870 86 / 2e-19 AS2 LBD36, ASL1 LATERAL ORGAN BOUNDARIES DOMAIN GENE 36, ASYMMETRIC LEAVES 2-like 1 (.1) AT1G65620 83 / 2e-19 AS2 AS2 ASYMMETRIC LEAVES 2, Lateral organ boundaries (LOB) domain family protein (.1), Lateral organ boundaries (LOB) domain family protein (.2), Lateral organ boundaries (LOB) domain family protein (.3), Lateral organ boundaries (LOB) domain family protein (.4) AT5G63090 82 / 2e-19 AS2 LOBB, LOB Lateral organ boundaries (LOB) domain family protein (.1), Lateral organ boundaries (LOB) domain family protein (.2), Lateral organ boundaries (LOB) domain family protein (.3), Lateral organ boundaries (LOB) domain family protein (.4) AT3G27650 81 / 5e-19 AS2 LBD25 LOB domain-containing protein 25 (.1) AT1G07900 82 / 6e-19 AS2 LBD1 LOB domain-containing protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018275 [exp] 91 / 1e-22 AT1G31320 243 / 2e-83 LOB domain-containing protein 4 (.1) Lus10040638 [exp] 91 / 1e-22 AT1G31320 244 / 1e-83 LOB domain-containing protein 4 (.1) Lus10031769 [exp] 90 / 2e-22 AT1G31320 193 / 8e-64 LOB domain-containing protein 4 (.1) Lus10031191 [exp] 89 / 3e-22 AT1G31320 199 / 2e-66 LOB domain-containing protein 4 (.1) Lus10031285 [exp] 90 / 4e-22 AT2G30130 226 / 3e-76 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Lus10031855 [exp] 89 / 5e-22 AT2G30130 220 / 4e-74 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Lus10023434 [exp] 88 / 1e-21 AT3G26660 131 / 5e-40 LOB domain-containing protein 24 (.1) Lus10033111 [exp] 89 / 1e-20 AT3G47870 194 / 5e-60 SIDECAR POLLEN, ASYMMETRIC LEAVES 2-like 29, LOB domain-containing protein 27 (.1) Lus10036665 [exp] 89 / 1e-20 AT3G47870 182 / 2e-55 SIDECAR POLLEN, ASYMMETRIC LEAVES 2-like 29, LOB domain-containing protein 27 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G092201 [exp] 96 / 8e-24 AT1G06280 139 / 5e-41 LOB domain-containing protein 2 (.1) Potri.005G097800 [exp] 93 / 1e-23 AT1G31320 193 / 6e-64 LOB domain-containing protein 4 (.1) Potri.003G149000 [exp] 93 / 2e-23 AT1G31320 241 / 2e-82 LOB domain-containing protein 4 (.1) Potri.013G123900 [exp] 94 / 5e-23 AT1G06280 135 / 2e-39 LOB domain-containing protein 2 (.1) Potri.007G066700 [exp] 91 / 5e-23 AT1G31320 216 / 3e-73 LOB domain-containing protein 4 (.1) Potri.010G184400 [exp] 91 / 6e-23 AT2G30130 227 / 7e-77 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.009G076900 [exp] 91 / 6e-23 AT2G30130 228 / 2e-77 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.001G281600 [exp] 91 / 7e-23 AT2G30130 248 / 4e-85 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1) Potri.001G081400 [exp] 91 / 7e-23 AT1G31320 228 / 3e-77 LOB domain-containing protein 4 (.1) Potri.008G072800 [exp] 91 / 8e-23 AT2G30130 229 / 8e-78 PEACOCK 1, Lateral organ boundaries (LOB) domain family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03195 [flax] [poplar] LOB Lateral organ boundaries (LOB) domain
Representative CDS sequence Show only first row Show all	>Lus10005284 pacid=23175313 polypeptide=Lus10005284 locus=Lus10005284.g ID=Lus10005284.BGIv1.0 annot-version=v1.0 ATGGACGGAGCAACATCCAGCGACAAATCTGGGGCTAATAGCAGCCGTCATAAATGCGCGGCGTGCAAGTACCAAAGACGGCGCTGCGCCGAAGACTGCG CGCTCTACCCTTACTTCCCAACCGACAGGACAAAGGAGTTCACCGCCGCCCATGCCGTCTTCGGCGTGAAAAACATGACCAGCATGCTCACCGAGATCAA CCTCCACGTTGACCGAAAAAAGGCCGTTGACTCCTTGGTCTGGGAAGCCAACGCCTGGGCCGAGGACCCAGTCAACGGCCCCCTCGGCCTCTACAAGAAG CTACAACAGGAGAAGAAAGAGCTGGAGAGTCAACTCCAGCTCGCCAAGCACCAAACGACGAGGATGTCGTCGTTTGGTGATTACGGCGGGGACGATGTTG GGTCATGTGCCATGATGATGATGAACCCTAGTGGGTTAGGGTTTCAGTCGTCGTTAATGGCGGAGTCCGGAGGGAATAATAGTTACGATTTTCAGTATTA TCAACAACGATTAGGGCATCAACTAATTCCTAGCTACCATCATTATGGTAACGGTCTACAGATTCATCAACAACAAGTACTGCCCATGTCGATTCCTAGA TATAATCCTAGCCTTGAAGGTCAAGTAAATATGTACAAGGATGATGCAATTGATGTCTCCACGATGGAGGGCTCTACGTCAACAGGCAATCAAGGTCAAT AG
AA sequence Show only first row Show all	>Lus10005284 pacid=23175313 polypeptide=Lus10005284 locus=Lus10005284.g ID=Lus10005284.BGIv1.0 annot-version=v1.0 MDGATSSDKSGANSSRHKCAACKYQRRRCAEDCALYPYFPTDRTKEFTAAHAVFGVKNMTSMLTEINLHVDRKKAVDSLVWEANAWAEDPVNGPLGLYKK LQQEKKELESQLQLAKHQTTRMSSFGDYGGDDVGSCAMMMMNPSGLGFQSSLMAESGGNNSYDFQYYQQRLGHQLIPSYHHYGNGLQIHQQQVLPMSIPR YNPSLEGQVNMYKDDAIDVSTMEGSTSTGNQGQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G30130	AS2	PCK1, LBD12, AS...	PEACOCK 1, Lateral organ bound...		Lus10005284 [exp]	0	1
AT4G08180		ORP1C	OSBP(oxysterol binding protein...		Lus10025695 [exp]	1.4	0.8266
AT5G12390		FIS1B	FISSION 1B, Tetratricopeptide ...		Lus10009707 [exp]	4.5	0.7573
					Lus10031263 [exp]	4.9	0.7072
AT2G44480		BGLU17	beta glucosidase 17 (.1.2)		Lus10031234 [exp]	6.8	0.7847
AT5G51490			Plant invertase/pectin methyle...		Lus10027203 [exp]	8.5	0.7494
AT5G06839	bZIP	TGA10, bZIP65	TGACG \(TGA\) motif-binding pr...		Lus10035499 [exp]	10.2	0.7515
AT3G17152			Plant invertase/pectin methyle...		Lus10017077 [exp]	14.0	0.6931
					Lus10010248 [exp]	14.7	0.6862
AT2G23945			Eukaryotic aspartyl protease f...		Lus10019961 [exp]	17.9	0.6800
AT4G23160		CRK8	cysteine-rich RLK (RECEPTOR-li...		Lus10024900 [exp]	27.0	0.7035

Compare expression of checked genes

Lus10005284 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.