Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G24530 144 / 3e-42 AAA-type ATPase family protein / ankyrin repeat family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034913 [exp] 205 / 7e-65 AT3G24530 748 / 0.0 AAA-type ATPase family protein / ankyrin repeat family protein (.1) Lus10011096 [exp] 141 / 2e-42 AT3G24530 471 / 5e-167 AAA-type ATPase family protein / ankyrin repeat family protein (.1) Lus10043218 [exp] 145 / 3e-42 AT3G24530 743 / 0.0 AAA-type ATPase family protein / ankyrin repeat family protein (.1) Lus10023642 [exp] 142 / 2e-41 AT3G24530 773 / 0.0 AAA-type ATPase family protein / ankyrin repeat family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G081000 [exp] 137 / 2e-39 AT3G24530 754 / 0.0 AAA-type ATPase family protein / ankyrin repeat family protein (.1) Potri.006G158600 [exp] 134 / 2e-38 AT3G24530 741 / 0.0 AAA-type ATPase family protein / ankyrin repeat family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005293 pacid=23175323 polypeptide=Lus10005293 locus=Lus10005293.g ID=Lus10005293.BGIv1.0 annot-version=v1.0 ATGAAGGTAACTTTCAATTACTGTTTGTGGGATGCATTTGGAATCTTCTTCTCTGCATATCCTAATGACCAAAAAATGTTCTTGAAACTTGTGTTTGTGC AGATCAAAGAAGCCGAGGGAGGGATTCTATTCGTAGATAAGGCATACCGTCTTATATCAATGCAGAAAGCAGATGATAAGGATTATGGCTTAGAAGCCTT AGAAGAGATAATGTCAGTTATGGATACTGGGAAGATTGTGGTCATATTCGCCGGGTACAGCGAACCCATGAAACTCGTAATTGCATCGAATGAAGGTTTC TGCAGAAGGGTAACTAAGTTTGAAAGAGTAGAAGAACGGTCGCCCAGCAGCGTTGATGAAGATTGA
AA sequence Show only first row Show all	>Lus10005293 pacid=23175323 polypeptide=Lus10005293 locus=Lus10005293.g ID=Lus10005293.BGIv1.0 annot-version=v1.0 MKVTFNYCLWDAFGIFFSAYPNDQKMFLKLVFVQIKEAEGGILFVDKAYRLISMQKADDKDYGLEALEEIMSVMDTGKIVVIFAGYSEPMKLVIASNEGF CRRVTKFERVEERSPSSVDED

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G24530			AAA-type ATPase family protein...		Lus10005293 [exp]	0	1
AT2G30860		GLUTTR, ATGSTF7...	glutathione S-transferase PHI ...		Lus10029816 [exp]	1.0	0.9566
AT5G17680			disease resistance protein (TI...		Lus10010221 [exp]	1.4	0.9462
AT4G25440	C3HZnF	ZFWD1	zinc finger WD40 repeat protei...		Lus10000559 [exp]	3.0	0.9264
AT5G24670		TAD3, EMB2820	tRNA adenosine deaminase 3, EM...		Lus10040753 [exp]	3.2	0.9248
AT3G15200			Tetratricopeptide repeat (TPR)...		Lus10031270 [exp]	3.5	0.9253
AT5G47090			unknown protein		Lus10021704 [exp]	5.2	0.9067
AT5G65550			UDP-Glycosyltransferase superf...		Lus10028863 [exp]	5.3	0.9100
AT3G56400	WRKY	ATWRKY70, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10034244 [exp]	5.7	0.9048
AT1G44750		ATPUP11	purine permease 11 (.1.2.3)		Lus10012606 [exp]	6.1	0.8691
AT4G04350		EMB2369	EMBRYO DEFECTIVE 2369, tRNA sy...		Lus10020041 [exp]	6.3	0.9073

Compare expression of checked genes

Lus10005293 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.