Lus10005294 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15930 101 / 7e-26 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G59200 101 / 9e-26 OTP80 ORGANELLE TRANSCRIPT PROCESSING 80, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G22410 94 / 3e-23 SLO1 SLOW GROWTH 1 (.1)
AT3G11460 93 / 6e-23 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G62890 93 / 7e-23 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G40410 91 / 3e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G49142 91 / 6e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G08820 90 / 7e-22 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G56310 90 / 9e-22 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G49170 89 / 2e-21 EMB2261 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010591 263 / 6e-87 AT5G66520 346 / 4e-112 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10039117 100 / 1e-25 AT3G24000 740 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10029436 100 / 1e-25 AT3G08820 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10038741 96 / 7e-24 AT3G24000 739 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10030225 94 / 1e-23 AT5G08510 472 / 2e-165 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10019731 95 / 2e-23 AT2G13600 436 / 3e-143 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10000117 94 / 2e-23 AT4G21065 404 / 5e-139 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10027311 94 / 3e-23 AT1G33350 621 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10039388 94 / 3e-23 AT5G43790 506 / 8e-176 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G471600 127 / 2e-35 AT2G20540 329 / 1e-106 mitochondrial editing factor 21 (.1)
Potri.016G128900 103 / 1e-26 AT3G08820 812 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G031600 103 / 1e-26 AT3G15930 784 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.006G105700 102 / 2e-26 AT3G08820 810 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G223900 100 / 1e-25 AT5G56310 508 / 1e-176 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.007G104700 97 / 3e-24 AT2G13600 834 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G369900 96 / 9e-24 AT5G66520 512 / 2e-175 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G103600 95 / 1e-23 AT1G08070 477 / 7e-160 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.002G027800 94 / 4e-23 AT1G25360 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.015G018700 94 / 5e-23 AT3G49170 1040 / 0.0 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10005294 pacid=23175324 polypeptide=Lus10005294 locus=Lus10005294.g ID=Lus10005294.BGIv1.0 annot-version=v1.0
ATGCTGGCTCGTGTAGGGAGGTTAGAGGAGGCACAAGAGCTCATCGAGTCGATGCCAGAGCAGGCAAACTCAGTGATATTAAGAGCACTCCTCAGCGGTA
GCAGGATGCATAACGACACCGGGAGAGCAAGTTGGGCATTCCGGAAACTGATGGAAGTTGAGCCAGTGTCAGGGGACATGTGTAAGATGGCAGAGCTTAT
GTTTGCAAGTGCAGGCAGGCAAAAGGAAGCAACAAAGATTAGGAGGATAATGAATGCAGCCGGAATGGAGAGGACAGCAGGATGCAGTTTCATTGAAGTA
GATGGCACTGTCCATCAATTTATTGCTGGAGACATTATGCATAGTCAAACTGAAGAGATTTATAGAATGTGCAGTACCATTAACACAAGTATGGGAAGAA
TATGA
AA sequence
>Lus10005294 pacid=23175324 polypeptide=Lus10005294 locus=Lus10005294.g ID=Lus10005294.BGIv1.0 annot-version=v1.0
MLARVGRLEEAQELIESMPEQANSVILRALLSGSRMHNDTGRASWAFRKLMEVEPVSGDMCKMAELMFASAGRQKEATKIRRIMNAAGMERTAGCSFIEV
DGTVHQFIAGDIMHSQTEEIYRMCSTINTSMGRI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G59200 OTP80 ORGANELLE TRANSCRIPT PROCESSIN... Lus10005294 0 1
AT3G05410 Photosystem II reaction center... Lus10029903 3.9 0.9242
AT5G66520 Tetratricopeptide repeat (TPR)... Lus10010591 6.0 0.8840
AT1G45230 Protein of unknown function (D... Lus10006488 6.0 0.8997
AT3G47430 PEX11B peroxin 11B (.1) Lus10038925 7.0 0.8766
AT1G68010 ATHPR1, HPR hydroxypyruvate reductase (.1.... Lus10019793 9.2 0.8784
AT4G11880 MADS AGL14 AGAMOUS-like 14 (.1) Lus10014144 15.5 0.8598
AT1G32470 Single hybrid motif superfamil... Lus10035374 18.6 0.8856
AT2G45350 CRR4 CHLORORESPIRATORY REDUCTION 4,... Lus10009290 18.8 0.7996
AT4G18780 LEW2, IRX1, ATC... LEAF WILTING 2, IRREGULAR XYLE... Lus10022449 20.1 0.8751
AT4G31500 SUR2, RNT1, RED... SUPERROOT 2, RUNT 1, RED ELONG... Lus10010066 20.8 0.8276

Lus10005294 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.