Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09510 40 / 0.0001 Ribonuclease H-like superfamily protein (.1) AT2G13980 39 / 0.0002 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026940 [exp] 82 / 1e-19 AT4G17510 327 / 4e-108 ubiquitin C-terminal hydrolase 3 (.1) Lus10000805 [exp] 69 / 2e-16 AT1G27220 40 / 7e-05 paired amphipathic helix repeat-containing protein (.1) Lus10004639 [exp] 61 / 3e-12 AT1G69160 55 / 4e-08 unknown protein Lus10009101 [exp] 56 / 2e-11 ND 35 / 0.003 Lus10037909 [exp] 52 / 6e-09 ND 38 / 0.002 Lus10027494 [exp] 49 / 9e-09 ND 34 / 0.006 Lus10031374 [exp] 49 / 6e-08 AT1G07650 1221 / 0.0 Leucine-rich repeat transmembrane protein kinase (.1.2) Lus10043127 [exp] 46 / 8e-07 AT5G46740 362 / 2e-115 ubiquitin-specific protease 21 (.1) Lus10021716 [exp] 43 / 3e-06 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005297 pacid=23168815 polypeptide=Lus10005297 locus=Lus10005297.g ID=Lus10005297.BGIv1.0 annot-version=v1.0 ATGCAACGGCTACAAAGGTGGCAGAAGCCCTGCGAAGCGGAAGCGACGGCGATGCTTAATGCGCTTGAGTGGATACATGACATGGGATATGCGTCGTTTG TGTTCGAGACCGATTGTCAGCTAGCCATCCAGAAGGTTACAGGAGCAAACAAGGATATCGCAGAGTTTGGAATGTTGATTTATCGTTGTCGTGATATCAT TGCAGACAATCTACTTTTCACAGTGTGTTGGGGTAGGAGAGATGGGAATAGGTTGGCACACGAGCTCGAGCTCGTCGGTCCTTTAGCCTTACATCTATTG TAA
AA sequence Show only first row Show all	>Lus10005297 pacid=23168815 polypeptide=Lus10005297 locus=Lus10005297.g ID=Lus10005297.BGIv1.0 annot-version=v1.0 MQRLQRWQKPCEAEATAMLNALEWIHDMGYASFVFETDCQLAIQKVTGANKDIAEFGMLIYRCRDIIADNLLFTVCWGRRDGNRLAHELELVGPLALHLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10005297 [exp]	0	1
					Lus10006529 [exp]	1.0	1.0000
AT2G06090			Plant self-incompatibility pro...		Lus10011896 [exp]	1.4	1.0000
AT3G52490			Double Clp-N motif-containing ...		Lus10024536 [exp]	1.7	1.0000
AT3G13790		ATCWINV1, ATBFR...	ARABIDOPSIS THALIANA CELL WALL...		Lus10015614 [exp]	2.0	1.0000
					Lus10035557 [exp]	2.2	1.0000
AT3G51590		LTP12	lipid transfer protein 12 (.1)		Lus10004068 [exp]	3.6	0.9163
AT3G26770			NAD(P)-binding Rossmann-fold s...		Lus10014228 [exp]	4.9	0.9969
AT5G53910			RING/U-box superfamily protein...		Lus10011380 [exp]	6.0	1.0000
AT2G01770		ATVIT1, VIT1	vacuolar iron transporter 1 (....		Lus10003704 [exp]	6.2	0.8868
					Lus10013260 [exp]	7.0	1.0000

Compare expression of checked genes

Lus10005297 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.