Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G33970 121 / 3e-34 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) AT4G09940 56 / 3e-10 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G33900 56 / 7e-10 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G33950 54 / 3e-09 Avirulence induced gene (AIG1) family protein (.1), Avirulence induced gene (AIG1) family protein (.2) AT1G33890 53 / 5e-09 Avirulence induced gene (AIG1) family protein (.1) AT1G33870 53 / 5e-09 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G26820 52 / 1e-08 ATPP2-A3 phloem protein 2-A3 (.1) AT1G33910 52 / 2e-08 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G33930 50 / 5e-08 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT4G09930 48 / 3e-07 Avirulence induced gene (AIG1) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005300 [exp] 180 / 3e-56 AT1G33970 321 / 7e-109 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Lus10009482 [exp] 111 / 3e-31 AT1G33970 148 / 9e-43 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Lus10005299 [exp] 110 / 1e-29 AT1G33970 339 / 5e-115 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Lus10009484 [exp] 79 / 6e-18 AT4G26220 255 / 1e-83 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10003732 [exp] 69 / 2e-14 AT1G33970 210 / 1e-65 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Lus10026891 [exp] 52 / 1e-08 AT2G26820 156 / 2e-45 phloem protein 2-A3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G104800 [exp] 130 / 6e-38 AT1G33970 314 / 3e-106 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5) Potri.019G077300 [exp] 122 / 9e-35 AT1G33970 345 / 2e-118 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF04548 [flax] [poplar] AIG1 AIG1 family
Representative CDS sequence Show only first row Show all	>Lus10005301 pacid=23168816 polypeptide=Lus10005301 locus=Lus10005301.g ID=Lus10005301.BGIv1.0 annot-version=v1.0 ATGGTGCTATTTGATAACAAGACTAAAGATGAGAAAAAGAGAGTTGAACAGGTTCAGCAGCTTATGACACTCACGAACAGCATCATAGCGCAGAATGGTG GTAAGCCATACACAGATGACATCTTTATCGAGATGCAGCAGGAGATGATCCTTCGTGACAAACAAGATGAGGTTAACTCCATGAAGGGTGCCTCAAATCA GCAATTGAATAATCTCAAGGAGGAAATGAACAAATCATATGAAAAACAGCTTAAACGCATTACTGAAGTGGTCGAGGCAAAGCTACGGGAGGCGACAAAT AAACTGGAGCAACAGCTAGCAGAAGAGCATGCGGCACACAGCTTAGGGCAGAGGAAGTTGCACAGAAAGCTCAGTTCAATCAAGCGATGA
AA sequence Show only first row Show all	>Lus10005301 pacid=23168816 polypeptide=Lus10005301 locus=Lus10005301.g ID=Lus10005301.BGIv1.0 annot-version=v1.0 MVLFDNKTKDEKKRVEQVQQLMTLTNSIIAQNGGKPYTDDIFIEMQQEMILRDKQDEVNSMKGASNQQLNNLKEEMNKSYEKQLKRITEVVEAKLREATN KLEQQLAEEHAAHSLGQRKLHRKLSSIKR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G33970			P-loop containing nucleoside t...		Lus10005301 [exp]	0	1
AT1G33970			P-loop containing nucleoside t...		Lus10005300 [exp]	11.4	0.7753
AT3G50360		CEN1, ATCEN2	CENTRIN 1, centrin2 (.1)		Lus10003320 [exp]	34.5	0.7017
AT3G03380		DEG7, DEGP7	degradation of periplasmic pro...		Lus10033594 [exp]	114.7	0.7002
AT3G12770		MEF22	mitochondrial editing factor ...		Lus10024876 [exp]	117.4	0.6990
AT2G27830			unknown protein		Lus10009391 [exp]	148.1	0.6820
AT3G12050			Aha1 domain-containing protein...		Lus10029141 [exp]	260.5	0.6494

Compare expression of checked genes

Lus10005301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.