Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G66650 70 / 5e-16 Protein of unknown function (DUF607) (.1) AT2G23790 63 / 1e-13 Protein of unknown function (DUF607) (.1) AT5G42610 60 / 1e-12 Protein of unknown function (DUF607) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022496 [exp] 117 / 7e-34 AT2G23790 371 / 2e-128 Protein of unknown function (DUF607) (.1) Lus10016799 [exp] 115 / 5e-33 AT2G23790 362 / 1e-124 Protein of unknown function (DUF607) (.1) Lus10000580 [exp] 88 / 1e-22 AT2G23790 314 / 1e-106 Protein of unknown function (DUF607) (.1) Lus10019663 [exp] 87 / 2e-22 AT2G23790 313 / 4e-106 Protein of unknown function (DUF607) (.1) Lus10010793 [exp] 52 / 2e-09 AT5G42610 270 / 2e-89 Protein of unknown function (DUF607) (.1) Lus10016305 [exp] 50 / 5e-09 AT2G23790 264 / 1e-86 Protein of unknown function (DUF607) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G031400 [exp] 56 / 4e-11 AT2G23790 333 / 1e-113 Protein of unknown function (DUF607) (.1) Potri.005G127800 [exp] 56 / 7e-11 AT2G23790 335 / 2e-114 Protein of unknown function (DUF607) (.1) Potri.002G133400 [exp] 48 / 3e-08 AT2G23790 290 / 1e-96 Protein of unknown function (DUF607) (.1) Potri.014G041000 [exp] 44 / 5e-07 AT5G42610 288 / 3e-96 Protein of unknown function (DUF607) (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005312 pacid=23175188 polypeptide=Lus10005312 locus=Lus10005312.g ID=Lus10005312.BGIv1.0 annot-version=v1.0 ATGGTGAAATCGAGGCTTGGAGACACGGAAAGAAACTGGATGCCACGCTGGGAGTTCGTTCGGATCTGCGAAGAAGTTTGTTCAGATACGGAGGAAGGGA ACCGGGTCGCCCAGACGCTTGACGAGTCCGGAACTGTAATCGTCTTGGGAGATGCGGTATTCCTCAAATCGAAGATGAACTGA
AA sequence Show only first row Show all	>Lus10005312 pacid=23175188 polypeptide=Lus10005312 locus=Lus10005312.g ID=Lus10005312.BGIv1.0 annot-version=v1.0 MVKSRLGDTERNWMPRWEFVRICEEVCSDTEEGNRVAQTLDESGTVIVLGDAVFLKSKMN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G66650			Protein of unknown function (D...		Lus10005312 [exp]	0	1
					Lus10016642 [exp]	1.0	0.8706
					Lus10020961 [exp]	1.7	0.7879
					Lus10007785 [exp]	2.8	0.7703
AT3G28860		ABCB19, ATMDR11...	P-GLYCOPROTEIN 19, MULTIDRUG R...		Lus10015595 [exp]	3.5	0.8030
AT4G11610		NTRB, ATNTRB	C2 calcium/lipid-binding plant...		Lus10000605 [exp]	7.5	0.7559
AT3G01680		SEOR1, SEOb	Sieve-Element-Occlusion-Relate...		Lus10017777 [exp]	10.1	0.7561
AT1G08500		AtENODL18	early nodulin-like protein 18 ...		Lus10009231 [exp]	10.2	0.7046
					Lus10034269 [exp]	11.0	0.7521
AT3G13850	AS2	LBD22	LOB domain-containing protein ...		Lus10003789 [exp]	12.5	0.7121
AT5G44120		ATCRA1, CRU1, C...	CRUCIFERINA, RmlC-like cupins ...		Lus10024889 [exp]	13.8	0.7600

Compare expression of checked genes

Lus10005312 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.