Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G31560 42 / 8e-06 HCF153 high chlorophyll fluorescence 153 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039571 [exp] 91 / 9e-24 AT4G31560 76 / 2e-17 high chlorophyll fluorescence 153 (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005314 pacid=23154629 polypeptide=Lus10005314 locus=Lus10005314.g ID=Lus10005314.BGIv1.0 annot-version=v1.0 ATGGTGGAGACTGGGGGCAGCGGTAGGCATGGGAGATGGTGGAGAGTGGTGAGGCGGGGAGGGCCGCCGAGCAGCAGCAGCTACGTTTTCGCTTTCGCGT TACCGTTCAGTCTTCTAATCTTCACCATCTTCACTTCTATAAGGATTTCGGATAAGCTGGACGAAGAGTACCTGGAAGAGCTTGAACTGAATGAGGCGAT CATGGAAGCAGAAGGAATCGAGTATGAAGAAGATGAAGATGAAAATATTGATGTCCAAGTCTCGCCGGAGAAGGAGGAAGAGGAAGAGGAAGTGCAGCTG CCACAACCTGCGTTGAGTGGGAGCCGAATTCGCAACCGGCCGAAACGGCAGGTTTGA
AA sequence Show only first row Show all	>Lus10005314 pacid=23154629 polypeptide=Lus10005314 locus=Lus10005314.g ID=Lus10005314.BGIv1.0 annot-version=v1.0 MVETGGSGRHGRWWRVVRRGGPPSSSSYVFAFALPFSLLIFTIFTSIRISDKLDEEYLEELELNEAIMEAEGIEYEEDEDENIDVQVSPEKEEEEEEVQL PQPALSGSRIRNRPKRQV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G31560		HCF153	high chlorophyll fluorescence ...		Lus10005314 [exp]	0	1
AT1G74070			Cyclophilin-like peptidyl-prol...		Lus10008990 [exp]	3.0	0.9444
AT1G65230			Uncharacterized conserved prot...		Lus10020202 [exp]	3.5	0.9414
AT4G30825			Tetratricopeptide repeat (TPR)...		Lus10036600 [exp]	4.0	0.9277
AT4G03280		PGR1, PETC	PROTON GRADIENT REGULATION 1, ...		Lus10039739 [exp]	4.1	0.9504
AT1G44920			unknown protein		Lus10007720 [exp]	5.3	0.9297
AT5G66190		ATLFNR1	ferredoxin-NADP\(+\)-oxidoredu...		Lus10028451 [exp]	5.5	0.9483
AT4G34350		HDR, CLB6, ISPH	CHLOROPLAST BIOGENESIS 6, 4-hy...		Lus10042345 [exp]	7.7	0.9401
AT5G20935			unknown protein		Lus10013382 [exp]	8.7	0.9237
AT3G09050			unknown protein		Lus10035515 [exp]	11.5	0.9322
AT2G06520		PSBX	photosystem II subunit X (.1)		Lus10033434 [exp]	11.7	0.9348

Compare expression of checked genes

Lus10005314 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.