Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G64690 45 / 1e-06 BLT BRANCHLESS TRICHOMES, branchless trichome (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017339 [exp] 121 / 8e-36 AT1G64690 105 / 2e-27 BRANCHLESS TRICHOMES, branchless trichome (.1) Lus10001665 [exp] 119 / 3e-35 AT1G64690 109 / 9e-29 BRANCHLESS TRICHOMES, branchless trichome (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G082600 [exp] 87 / 1e-21 AT1G64690 79 / 1e-16 BRANCHLESS TRICHOMES, branchless trichome (.1) Potri.003G147900 [exp] 82 / 3e-20 AT1G64690 66 / 2e-12 BRANCHLESS TRICHOMES, branchless trichome (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10005316 pacid=23154628 polypeptide=Lus10005316 locus=Lus10005316.g ID=Lus10005316.BGIv1.0 annot-version=v1.0 ATGGGCGATTTGGTGCCGGGGGAATTTAGGAAACTAAACCTCTATGTCGGAGTCGGCGGAGGCAGAGGAGGAGGAGGAATTGGGTTAGTTGAGAATCATC ACAGAAGGCGAGGGATCAGAGGGTTCGTTGAGTTTCCGAGGACGGTTCATCGGAGCAAAGACGGATCGAAGAGCAGTAGCAAGCATTGGGGGACGAAGCT GCAGTGTCAGAAGGCTCAGCTCAGGATCTTGTTGAAACAGAGGAGTCCGATCCAATCCAATTCTTTCATTATTAGTTGA
AA sequence Show only first row Show all	>Lus10005316 pacid=23154628 polypeptide=Lus10005316 locus=Lus10005316.g ID=Lus10005316.BGIv1.0 annot-version=v1.0 MGDLVPGEFRKLNLYVGVGGGRGGGGIGLVENHHRRRGIRGFVEFPRTVHRSKDGSKSSSKHWGTKLQCQKAQLRILLKQRSPIQSNSFIIS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G64690		BLT	BRANCHLESS TRICHOMES, branchle...		Lus10005316 [exp]	0	1
AT1G73050			Glucose-methanol-choline (GMC)...		Lus10033390 [exp]	7.6	0.5993
AT2G16710			Iron-sulphur cluster biosynthe...		Lus10021368 [exp]	32.6	0.6250
AT4G39740		HCC2	homologue of copper chaperone ...		Lus10022501 [exp]	44.0	0.6102
					Lus10019466 [exp]	60.1	0.6079
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10024706 [exp]	106.4	0.5752
					Lus10041761 [exp]	151.2	0.5595
					Lus10038003 [exp]	152.5	0.5320
AT5G52390			PAR1 protein (.1)		Lus10040714 [exp]	156.6	0.5389
AT5G44700		GSO2, EDA23	GASSHO 2, EMBRYO SAC DEVELOPME...		Lus10039958 [exp]	219.4	0.5298

Compare expression of checked genes

Lus10005316 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.